CAZyme Information: PADG_04497-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_04497-t30_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	KN275961|CGC1	45933.40	7.2980

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275961:93960-95561(-)

Full Sequence      

MLLPKGGVTWKSAKARMPPVRFLVSVISRPRFLISVVLTGLVLLLWKGLSSSAAEMQSFY
CFGPSKSPVEMSANELVDWNAHLQTPVLFNHHEPYQLNSSTIQTVDLNTVTSTPKAVLNG
ERVLIVTPLRDASPYLNKYFDLVSELTYPHHLIDIAFLVGDSADDTLAVLSAELDRIQKS
EKTAFRSALIVQKNFGATVSMEVNSKHGFAAQGPRRKAIAKARNFLLSAALKPEHSWVYW
RDVDIVDSPKRIIEDFVAHDKDILVPNIWFHRYENGRDIEGKFDYNSWRESEKGLKLAAS
LDKDTILAEGYKEYDTGREYLVSMGDWRNNKDQEVELDGIGGVNIIVKADVHRAGINFPC
YAFENQAETEGFAKMAKRAGYQVVGLPNYVVWHIDTKEKAGNLGNRPAY

Enzyme Prediction     

No EC number prediction in PADG_04497-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	99	361	2.6e-105	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.78e-152	101	362	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51499.1|GT62	7.14e-261	1	409	1	409
QSS69525.1|GT62	2.90e-260	1	409	1	409
QKX56390.1|GT62	3.58e-243	1	409	1	411
QGA13607.1|GT62	1.03e-235	1	409	1	411
BCS29009.1|GT62	1.51e-232	1	409	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.82e-64	106	395	10	301	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	1.48e-96	121	394	98	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	1.61e-95	88	394	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	7.36e-74	97	394	167	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	4.24e-73	97	394	71	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	7.67e-67	97	395	68	367	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000012

TMHMM  Annotations     

There is no transmembrane helices in PADG_04497-t30_1-p1.