CAZyme Information: PADG_03299-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_03299-t30_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1450		159783.32	5.2139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275959:3038048-3043395(-)

Full Sequence      

MATRSHGLLQALLIWTLLSLQILASVMSPVLINPLRNAHENKMHDLVPRNQLGTNVVLPP
SVAKATQLDIDEARRIVDDAIKEASALNKARLEHPLRNHYQLKPGTGTSRRGEPNGDAPP
PPLFQISKEIAAAAALIAEVEAVAETRDSSKSKADYSYIDVMYNRTVVRRADAFWMEDIE
RKGAWPFGNDRSFKVFRNVKDYGAVGNGVNDDTEAIKRAIADTGTCGEKCNGATTKNSIV
YFPSGTYLVSSTIETHFGSQVIGNANDRPVIKAASSFIGLGVLSTNHYVENGGNGTDGNA
KEWYVNTANFYRQIRNFRIDITATNQGAYIAALHYQVAQATSLSNIDFIVSSNPGTTQQA
IFSENGSGGILSDLTFTGGNFGIYGGNQQFTAQRLQFTNCKTAVQLIWDWGWIWKNIQIT
GSTTGFKLMSEDNVPRSGSIMVLDSIFRNTDTALLTFPAKQERAKGTTGITLDNVAFDKV
RNAVADNQGKVYLAGSVGSINTWALGPVYFDSSQRDFTLGMSFDTSRESTLLADRLSALP
KAPFFERPRPQYEGVPVSDFVHMKDYAKGDGVTDDTEAFQRVLREHSTDRIIFVDAGSYI
LTDTIIIPVGARIVGEGWSQLVASGPNFQDERAPRSLVLVGQPGDTGEVEIQDLLFTTKG
PTAGAVLVEWNIKASSPGSAGMWDSHVRIGGASGTKLTSTECPAIRNGVNSDDCKSGSLM
MHITESSSAYMENVWLWVADHDIDDPHLQDDNNTMVQTSVYSARGLLVESAEATWLYGTS
SEHAIYYQYNFYKAKNVFAGMIQTESPYYQPTPKPPAPFEGAIGVLPGDPDFGGCRDGTP
GCDASWGLRIINSSQTYIAGAGLYSWFTTYTQECVDKRNCQNALIELKGNGPRVRIHNLI
TIGATNMLTSDGSEVPSQDNLAVDYHPYWSQVTVIDPFQNRGARGLTTPTSPDKSGRQCP
NIPPEVNVPGGKYPPDIPVMGRPGKSDHGYFTLVNGSPYNWMLTYNHSYQLDQWKWHNVP
AGESIQGEWKFARASNRYDDKGEAYYKIDGTDKSFQIWARFYEDDPENAFHLRVLYDGLE
TKDVKRGTSLDYRTRGGYGGMRAINWVLTGSEEEGYWSSHSPPVAWMSSILNIIGDRKVK
HVCMPGSHDAGMSKLDGHTQFADEGNTLTQYLSVYDQLRRGSRYFDVRPAIGNGGKYLTG
HYSYVDVLGIGWQGGNGESIQEIVDGINRFTAENPELIIINLDLTLDTDNGYKPFNDEQW
SKTFDLFEGVKYLQGNLEGDLTERTMNDYIGAGGAAVIVIASGGPTRPEKGIYSNRQFPR
YDSYSNSDDPAAMADDQLAKLKGNRNIVSDTTERKDTFHIFSWTLTLSRVFERTIADQSI
ELGYDPLFWRGYHAFTPFSYPNVVYMDFIGSADQSETTLEKTHGEVTALAMAVNMELASR
NCYVGGGTMV

Enzyme Prediction     

No EC number prediction in PADG_03299-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	168	920	2e-254	0.9716216216216216

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
176558	PI-PLCXDc_like_2	1.69e-115	1131	1434	1	300	Catalytic domain of uncharacterized hypothetical proteins similar to eukaryotic phosphatidylinositol-specific phospholipase C, X domain containing proteins. This subfamily corresponds to the catalytic domain present in a group of uncharacterized hypothetical proteins found in bacteria and fungi, which are similar to eukaryotic phosphatidylinositol-specific phospholipase C, X domain containing proteins (PI-PLCXD). The typical eukaryotic phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11) has a multidomain organization that consists of a PLC catalytic core domain, and various regulatory domains. The catalytic core domain is assembled from two highly conserved X- and Y-regions split by a divergent linker sequence. In contrast, eukaryotic PI-PLCXDs contain a single TIM-barrel type catalytic domain, X domain, and are more closely related to bacterial PI-PLCs, which participate in Ca2+-independent PI metabolism, hydrolyzing the membrane lipid phosphatidylinositol (PI) to produce phosphorylated myo-inositol and diacylglycerol (DAG). Although the biological function of eukaryotic PI-PLCXDs still remains unclear, it may distinct from that of typical eukaryotic PI-PLCs.
403800	Pectate_lyase_3	2.01e-81	196	427	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
176529	PI-PLCXDc_like	2.43e-53	1132	1434	2	288	Catalytic domain of phosphatidylinositol-specific phospholipase C X domain containing and similar proteins. This family corresponds to the catalytic domain present in phosphatidylinositol-specific phospholipase C X domain containing proteins (PI-PLCXD) which are bacterial phosphatidylinositol-specific phospholipase C (PI-PLC, EC 4.6.1.13) sequence homologs mainly found in eukaryota. The typical eukaryotic phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11) have a multidomain organization that consists of a PLC catalytic core domain, and various regulatory domains. The catalytic core domain is assembled from two highly conserved X- and Y-regions split by a divergent linker sequence. In contrast, eukaryotic PI-PLCXDs and their bacterial homologs contain a single TIM-barrel type catalytic domain, X domain, which is more closely related to that of bacterial PI-PLCs. Although the biological function of eukaryotic PI-PLCXDs still remains unclear, it may be distinct from that of typical eukaryotic PI-PLCs.
176500	PI-PLCc_bacteria_like	7.08e-32	1132	1413	2	262	Catalytic domain of bacterial phosphatidylinositol-specific phospholipase C and similar proteins. This subfamily corresponds to the catalytic domain present in bacterial phosphatidylinositol-specific phospholipase C (PI-PLC, EC 4.6.1.13) and their sequence homologs found in eukaryota. Bacterial PI-PLCs participate in Ca2+-independent PI metabolism, hydrolyzing the membrane lipid phosphatidylinositol (PI) to produce phosphorylated myo-inositol and diacylglycerol (DAG). Although their precise physiological function remains unclear, bacterial PI-PLCs may function as virulence factors in some pathogenic bacteria. Bacterial PI-PLCs contain a single TIM-barrel type catalytic domain. Its catalytic mechanism is based on general base and acid catalysis utilizing two well conserved histidines, and consists of two steps, a phosphotransfer and a phosphodiesterase reaction. Eukaryotic homologs in this family are named as phosphatidylinositol-specific phospholipase C X domain containing proteins (PI-PLCXD). They are distinct from the typical eukaryotic phosphoinositide-specific phospholipases C (PI-PLC, EC 3.1.4.11), which have a multidomain organization that consists of a PLC catalytic core domain, and various regulatory domains. The catalytic core domain is assembled from two highly conserved X- and Y-regions split by a divergent linker sequence. In contrast, eukaryotic PI-PLCXDs contain a single TIM-barrel type catalytic domain, X domain, which is closely related to that of bacterial PI-PLCs. Although the biological function of eukaryotic PI-PLCXDs still remains unclear, it may be distinct from that of typical eukaryotic PI-PLCs. This family also includes a distinctly different type of eukaryotic PLC, glycosylphosphatidylinositol-specific phospholipase C (GPI-PLC), an integral membrane protein characterized in the protozoan parasite Trypanosoma brucei. T. brucei GPI-PLC hydrolyzes the GPI-anchor on the variant specific glycoprotein (VSG), releasing dimyristyl glycerol (DMG), which may facilitate the evasion of the protozoan to the host's immune system. It does not require Ca2+ for its activity and is more closely related to bacterial PI-PLCs, but not mammalian PI-PLCs.
176557	PI-PLCXDc_like_1	6.20e-11	1144	1335	14	185	Catalytic domain of uncharacterized hypothetical proteins similar to eukaryotic phosphatidylinositol-specific phospholipase C, X domain containing proteins. This subfamily corresponds to the catalytic domain present in a group of uncharacterized hypothetical proteins found in bacteria and fungi, which are similar to eukaryotic phosphatidylinositol-specific phospholipase C, X domain containing proteins (PI-PLCXD). The typical eukaryotic phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11) has a multidomain organization that consists of a PLC catalytic core domain, and various regulatory domains. The catalytic core domain is assembled from two highly conserved X- and Y-regions split by a divergent linker sequence. In contrast, eukaryotic PI-PLCXDs contain a single TIM-barrel type catalytic domain, X domain, and are more closely related to bacterial PI-PLCs, which participate in Ca2+-independent PI metabolism, hydrolyzing the membrane lipid phosphatidylinositol (PI) to produce phosphorylated myo-inositol and diacylglycerol (DAG). Although the biological function of eukaryotic PI-PLCXDs still remains unclear, it may distinct from that of typical eukaryotic PI-PLCs.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51941.1|GH55	0.0	1	1450	1	1446
QSS69923.1|GH55	0.0	345	1450	2	1107
QBZ61798.1|GH55	0.0	41	1447	41	1428
UKZ47543.1|GH55	0.0	62	938	64	932
UKZ74106.1|GH55	0.0	62	938	64	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	7.90e-182	174	915	6	736	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	3.06e-169	172	920	24	743	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	2.25e-06	141	273	27	149	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	1.90e-169	170	920	39	862	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	8.04e-144	172	923	46	776	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	3.68e-51	167	927	30	752	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.058814	0.941165	CS pos: 28-29. Pr: 0.3242

TMHMM  Annotations     

Start	End
7	29