CAZyme Information: PADG_02784-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PADG_02784-t30_1-p1
• CAZy Family: GH13
• CAZyme Description: chitin synthase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786		88963.42	6.6958

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb18	8522	502780	132	8390

• Gene Location: location=KN275959:1317806-1320470(+)

Full Sequence      

MVAYTYRSAYDESEWATKDIIYVSILGPFLVAAFLEWFLWLAAFLYCLGKVFVKADHWSI
KVLAVVMMVFFTAFRLVTNSVGRTKRIKEVLDECTAPKTVIVMPVYKEEPDVLIKAVNSV
VDCDYPPSCIHVFLSYDGGQVDESYLTVVGHLGIPVTLKSYPESIDVSYKGARITVSRFK
HGGKRHCQKQTFKLIDKVYAKYLQRHDNLFVLFIDSDCILDRVCLQNFMYDMELKPGSKR
NMLAMTGVITSTTQKNTLITLLQDMEYIHGQLFERSVESGCGSVTCLPGALTILRFSAFR
KMAKYYFADKAEQCEDLFDFGKCHLGEDRWLTHLFMIGAKERYQIQMCTSAFCKTEAVQT
FRSLLKQRRRWFLGFITNEVCMLTDIRLWYRYPMLCLVRFMQNTIRTTALLFFIMIISVM
TTSNRIENLPVGFIAVSLGLNYLLMFYFGAKLRRYKAWLYPLMFLLNPFFNWLYMVYGIF
TAGQRTWGGPRADAAAADENTTPEEAAVKAKATGDELNVNVDTFRAGAEGKTSVVPIHPS
EGIEGRFAAPDLQPNGYYYTENENISTMTFPDFLPRNYNHSHNANANTNGHGNLNVTYQG
LSPLPLHPRASFDSDWTNGSSSIIHMPRTVESIMGEEDQRKLQLARQSRACSSVGVEWGD
YDEQYQRDDVSERDRDRERGGSNSGLAFQAYDGGSGNLTPPDTIRGRSAGRSPLGRNSPV
HAVEDGDDVAAAELEGGLRDVGDDAEQQQQEEGRDQGGEDYGKKGRRPAWLVKRSRDCNP
DPGDMV

Enzyme Prediction     

EC	2.4.1.16:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	210	497	1.2e-25	0.5597722960151803

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	3.45e-26	180	371	50	237	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	1.01e-22	63	482	20	413	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	5.41e-17	210	491	204	493	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	2.72e-16	101	301	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	3.69e-10	210	420	1	183	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53509.1|GT2	0.0	11	786	8	831
QSS75901.1|GT2	0.0	11	786	8	831
QVM11300.1|GT2	0.0	32	730	3	740
BCR86377.1|GT2	0.0	13	662	11	694
AAP74955.2|GT2	2.81e-314	58	730	44	703

PDB Hits     

PADG_02784-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78746|CHSD_ASPFU	3.06e-293	74	654	79	633	Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsD PE=3 SV=1
sp|O13395|CHS6_USTMA	1.38e-10	210	491	573	857	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|O13394|CHS5_USTMA	2.57e-10	243	491	1005	1265	Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS5 PE=3 SV=3
sp|O13353|CHS4_MAGO7	3.16e-10	211	491	863	1150	Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CHS4 PE=3 SV=2
sp|P78611|CHSD_EMENI	4.12e-10	211	499	847	1142	Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsD PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000004

TMHMM  Annotations     

Start	End
20	42
57	79
409	426
431	450
457	479