CAZyme Information: PABG_12483-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_12483-t30_1-p1
• CAZy Family: GT66
• CAZyme Description: chitin synthase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
907	KN305545|CGC1	103804.81	8.4132

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305545:211320-214439(+)

Full Sequence      

MNPNRSDPHRTQSPGEPLHGYQLEGNPNRTHSSGRPFRGYQLEDNRYQQYGHLEMPSSDR
LADQPTYSVENIQNSYGHNEAYETANPYRASPLARTEYTISPEAHHDAYYTQPYQPTAPS
PSEYDVQPFPSQTPQPYHDDEVPILQNPYRPNPQLNPQLAYQESALAPTPSPAPIRRWKT
VKEVQLFNGNLVLDCPIPPRLLSQVNHAKPPERDEFTHMRYSAATCDPADFYNERFTLRQ
RLFAKPRHTELFIVVTMYNEDDFLFARTMIGVFENIEYMCSRTNSKTWGKEAWKKIVVCV
VSDGRAKINPRTRAVLAGLGVYQDGIAKQQVNGKDVTAHIYEYTTQIGMELKGNQVHLRP
RSGVPVQMIFCLKEKNQKKINSHRWFFQAFGRVLDPNICVLLDAGTKPGKDSIYHLWRAF
DLQPMCGGACGEIKAMLSHGKRLINPLVAAQNFEYKMSNILDKPLESAFGFISVLPGAFS
AYRYVALQNDKNGQGPLEKYFAGEKMHGANAGIFTANMYLAEDRILCFELVAKRNCQWLL
QYVKSSTGETDVPDRMAEFILQRRRWLNGSFFAAVYAITHFYQIFRSRHSFTRKFMFIIE
FVYQTINMLFAWFAIEPMLTCFCQGNFFLVFHILTKSLSAANLLGQVGRVLGVIFEWLYL
VTLATSFILALGNRPQGSNKFYMTMVYFWIGIMIYLTFAAIFITVKSIQAETADNDFSFR
SIFQNHQFFSMIVSLMSTYFLQYILLTPTYINVLNIYAFCNTHDITWGTKGDDKAEKLPS
ANLKPSGKVDVSIPQDDGDLNAQYEAELLKFASKPPKETRVVSEEDKQEDYYRGFRSAVV
LVWIFCNFALAAVVLSAVGLDRINLDTSREQRSTVYMAVVLWSVAGLSLFRFMGAMWFLV
TRLFRGV

Enzyme Prediction     

No EC number prediction in PABG_12483-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	257	420	6.1e-77	0.9938650306748467
GT2	398	624	2.3e-19	0.42125237191650855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.94e-111	257	420	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	5.36e-98	253	573	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.06e-35	183	256	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	5.45e-29	369	710	115	417	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	6.35e-15	253	487	1	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS55730.1|GT2	0.0	1	907	19	916
QSS72325.1|GT2	0.0	1	907	19	916
QSS60984.1|GT2	0.0	1	890	19	899
AAF82801.1|GT2|2.4.1.16	0.0	1	903	19	910
BCS07221.1|GT2	0.0	1	907	20	914

PDB Hits     

PABG_12483-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30601|CHS2_EXODE	0.0	48	903	47	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30588|CHS3_NEUCR	0.0	64	907	16	888	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30583|CHSC_EMENI	0.0	1	907	21	918	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|Q12564|CHSA_AMPQU	0.0	61	903	39	898	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1
sp|J9VGT6|CHS8_CRYNH	1.96e-279	175	906	301	1031	Chitin synthase 8 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS8 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

Start	End
566	585
609	631
651	673
686	708
738	760
837	859
879	901