CAZyme Information: PABG_11571-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_11571-t30_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1145	KN305533|CGC2	127097.10	6.9163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305533:2555080-2560296(-)

Full Sequence      

MAAHYKKYLAEKVINEQEIVSSQQPQMAASNTRSNALKNDQVTYRSLSRALKVHSNLAKR
MLYEFHRVENSKKPQSVHATYLITGTQLPTQRHHVLNGDAKKDGDDDIMQCSPFLSSQTG
FQEDDTEDSPPVTSITLVREEDLSEAKSQFQTIFSIFMHSVQPTRVQDMNVMSDIGHDIF
ESQIEDPLEYGKIYGMILNKNVMRRSGVPPPAPPPAAPAAAITKPKPKPVNAEEPSRPTK
QEDPPLPPARAKDATSQPSSRVPSWQGAATAAESGSSSLKRGVSGNIFQAFARSKAKVKK
ETPEVESVFMLDDSSEEEREDLFLDTGTRSSSSKRESRREREEKLRKMMDEDEEMADAPE
PPPPQSCEAVETLQSPQSKAGEEEEEEEEEGKEKGKEKDKEKEASAHPATKGRRRGRRQV
MKKTTAMDEDGFLITEEQPVWESFSEDDAPSVARRKPVVAVHAKPAGGRGGAKTGQGSIT
AGLPSYPSRHVVQYIEKRDENVRKGERDTRAPGADGSTTDIRTLRCLGRTGQLSGAGPFC
PFCPFCPFSPFCPGFAKYSSCATTTIYRAHAAMKLPSRAAVLALLVCSNSARAADAHGQH
YLQDSRQSLMDACPDYAEYSAVKQLTGYLMFMNSDGPLKLPFQRPVEACRTFVSPAVEQV
IEEVTSRMVDKDLAQIFRNAFPNTLDTTVRWHTKGSESLLSPPPKKPKKPKKKPPVTLPS
DEPWQGPQSFIVTGDINAEWLRDSANQLTQYQSLSKKDPALQTLIHGAINTQTEFILQAP
YCNAFQPPPPSKLNPVLTPQHDIVHPAYERSVAFECKYELDSLASFLALSNKFYASTQST
AFVTPRWYRAVHTILRVIDEQSQPTFDSENGRYGRNEYTFLRQTTLGTETLNLGGIGNPL
NNGTGLVRSAFRPSDDATIFGFFIPANAQMSVELRRTADTIRAAKGPEDLIKTLRQRAAT
IERGIREYGIVRHPKYGHVYAYEVDGYGSQVLMDDANLPSLLSLPLLGFGKVGDDVYRNT
RRMVLEKAGNPYYLVGEAFEGVGGPHVGLQSAWPMSVLIRARTSTDDEEIIQSLGMVRNA
SLLGLVHESVNVNNVSEYTRSWFAWANSMFAQTILDLAERKPEIVFGKRGRRYRIAEDVA
MGVEE

Enzyme Prediction     

No EC number prediction in PABG_11571-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	670	1115	7.5e-158	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	670	1115	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	7.87e-144	648	1123	1	428	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
370537	CDC27	7.16e-89	42	480	3	421	DNA polymerase subunit Cdc27. This protein forms the C subunit of DNA polymerase delta. It carries the essential residues for binding to the Pol1 subunit of polymerase alpha, from residues 293-332, which are characterized by the motif D--G--VT, referred to as the DPIM motif. The first 160 residues of the protein form the minimal domain for binding to the B subunit, Cdc1, of polymerase delta, the final 10 C-terminal residues, 362-372, being the DNA sliding clamp, PCNA, binding motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX57883.1|GH125	6.04e-266	1	1126	1	1010
QSS68485.1|GH125	1.74e-255	575	1137	4	542
QSS49978.1|GH125	2.47e-255	575	1137	4	542
QSS59948.1|GH125	6.99e-255	575	1137	4	542
QVM13217.1|GH125	2.29e-244	602	1137	27	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	4.17e-87	644	1117	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	3.27e-85	644	1117	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.56e-82	644	1117	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	5.73e-66	657	1116	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	8.64e-66	657	1116	12	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.30e-166	612	1125	26	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PABG_11571-t30_1-p1.