CAZyme Information: PABG_07795-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_07795-t30_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		82586.37	8.2245

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305562:12767-15115(-)

Full Sequence      

MAAPSPSTVVTVLDSPLPPAPSPNTVLSPLQWKTLLALADIVIPSIRSKSEGGSLGDFII
DDAEYVLAAHGIHSNADPSTHPDLAVRYLNENASSIPEFKESLSRILGQQIPEDTRRGIC
IILNSLNSRPISFALTGYFAPIQCHSYRVREAIFRGWATSTLPPMRTIYRSLILLFNKAW
ISLSPTLPEILGFPQVPIGYAPSEGYPYQFVQIPPGDNAEIISTEVVVIGSGCGAAVAAK
NLAEAGHSVIVLEKAYHFPERHFPMTMRHASSNMFENGGANISDDGSIAAISGSTWGGGG
TINWSASIQTQSYVRQEWAKKGMPFFTSSEYQKCLDRVCERMGVNTEHVNHNNPNRVLLD
GARKLGYAAQTVPQNTGNQEHWCGHCTLGCASGCKNGPHVTFLADAARAGAQFIEGFYAE
RILFKEGNVGNCLAHGVQGIWTSRDINHGTSGQPVIKRKVVIKARKVVVACGSLQTPLLL
LRSGLKNPQIGRNLYLHPVVVLSAVFKEEMLPWEGGILTSMVTEFENVDGQGHGAKIETL
TAVPSFFLPVFPWNDGIMYKRFAATLRKMAGFITLTRERDAGRVYPDPVDGRCRIAYTPS
HFDRKNMMEAVIGAAKIAYVCGAQEIYTTSRDIPTFIRPERLVTETCRPEEGINHTSFQA
WIKKVRHVYSPLAPERTAFASAHQMGTCRMGNAPKSSVVDPTGKVWGTEGLYVTDASVFP
SASGVNPMVTNMAISDWTSRNVSKVLRGEDVSFAPRL

Enzyme Prediction     

No EC number prediction in PABG_07795-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	220	740	2.6e-47	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	4.55e-49	303	499	34	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	2.42e-34	225	735	9	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.82e-30	579	734	2	139	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	3.57e-09	660	721	462	510	choline dehydrogenase; Validated
274888	Rv0697	3.94e-06	460	730	240	474	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	2.44e-189	17	746	16	734
BDD69329.1|AA3_2	3.28e-09	458	736	250	526
UPK89107.1|AA3_2	5.65e-09	285	744	83	529
UJO12159.1|AA3_3	3.22e-08	225	736	17	579
BAE61169.1|AA3_1|AA8	3.79e-08	225	742	255	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	3.44e-07	466	749	264	533	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7DVE_A	5.85e-07	462	743	263	505	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
2JBV_A	7.88e-07	466	749	264	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	7.88e-07	466	749	264	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.75e-86	218	750	233	750	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	4.62e-81	217	751	230	749	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	1.68e-80	216	730	230	726	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|Q9LW56|FAO3_ARATH	1.15e-79	222	744	231	738	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|O65709|FAO4A_ARATH	3.96e-78	222	747	222	723	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PABG_07795-t30_1-p1.