CAZyme Information: PABG_07755-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_07755-t30_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		40379.85	6.7720

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305558:48847-49902(+)

Full Sequence      

MYFAGGFPRKIWQIWKVDPLDFEERDLRCARSWTSKNPTHRYEVLTDQNDLYYLETHFGP
KGFNRPDIIYVYRSLTARIIKADLLRYLIMYVEGGVYADIDVEALRPLDRFIPDRFNEKN
IDMVIGVEIDQPEFRKHPVLGPKSQSFCQWTFICKPRLPVMLKLVDNIIRWLNELSKKQG
VPISQLTLDFDDVISGTGPSAFTNAILEDMSHRTGNEVNWDVFHNMAESKVVGGILVLTV
EAFAAGQGHSDSGNHNTRTALVKHHYHASGWPSNHRRYKHPMFDEVETCNWNAQCVAEWD
KNKADFEALPLEEQAKRIAVKQFADSIKNPVKSNPNPVPNQNAVQNPIQDP

Enzyme Prediction     

No EC number prediction in PABG_07755-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	27	113	2.1e-18	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.07e-24	7	263	82	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.15e-13	24	114	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96510.1|GT32	1.56e-179	7	326	67	386
QMW40889.1|GT32	1.66e-179	7	339	51	388
BAE58544.1|GT32	1.66e-179	7	339	51	388
UDD56882.1|GT32	1.66e-179	7	339	51	388
BCS17076.1|GT32	1.93e-179	7	326	73	392

PDB Hits     

PABG_07755-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	5.04e-33	3	271	138	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.28e-29	7	264	99	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.85e-25	7	243	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.24e-21	8	264	97	463	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.88e-06	4	109	54	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PABG_07755-t30_1-p1.