CAZyme Information: PABG_07721-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_07721-t30_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		48361.84	9.4566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305556:50155-51520(+)

Full Sequence      

MPSLFKSPTLVFTAAILLRVILLFYGLYQDAHSPVKYTDIDYFVFTDAAKFVSHGRSPYE
RATYRYTPLLAWLLVPTAWFGGFWFSFGKVLFALADIAAGWLIVRVLCQQRYLHMDIPRA
LKYTSIWLLNPMVATISTRGSSESLLGVMVIALVWAVLERRIGLAGALLGLGVHFKIYPF
IYAPSIIWLLGDGKWHKEDTSKISFLSITTCLRSFVNPSQILLTFTSLAVFSVLNITMYL
IYGLPFIQHTYLHHATRVDHRHNFSPYNILLYLSSSPTVQDASLGSNLESLAFIPQLSLS
AVLIPLVLAKKDLAGTMLAQTFAFVAFNKVCTSQYFLWYMIFLPLYLPYSSFIKQPFVGT
TALALWVAGQALWLHQGLHLEFLGISTFTPGLFFASLTFFAVNVWILGIIVADVGRSSAI
HATSVADKGSGSD

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	410	7.9e-91	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.26e-84	2	411	3	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.88e-64	136	411	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62928.1|GT50	8.40e-237	1	418	1	418
QSS50664.1|GT50	2.79e-235	1	418	1	418
QSS74503.1|GT50	2.79e-235	1	418	1	418
BCS05340.1|GT50	1.03e-183	3	418	10	423
BCS16894.1|GT50	1.03e-183	3	418	10	423

PDB Hits     

PABG_07721-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	3.02e-181	1	414	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	2.06e-174	1	418	1	425	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	1.03e-171	1	415	1	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.79e-162	1	418	1	412	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	2.04e-162	3	416	21	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000013	0.000001

TMHMM  Annotations     

Start	End
10	28
69	88
136	158
165	187
221	243
335	353
390	412