CAZyme Information: PABG_06860-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_06860-t30_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		43461.98	9.4519

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305544:247892-249436(+)

Full Sequence      

MRKGYLIFIIVNVLIVAFLVRSVFTLLTLLIEDASADAIRRSDLPSPNSSLLETRPQLIP
KIIHQTYKNYSIPLIWQEAQKSCMVLHSDYEYKLWTDEKSKEFIAKEYPWFLETFENYPY
NIQRADAIRYFVLAHYGGTYIDLDDGCNRRLDPLLSYGAWVRRTAPTGISNDVMGAVPQH
PFFLRVIDSLQAYNRNWALPYITVMYSTGPLFLSVIWKEYMLSEPFKTDRVRILMPDEYN
RHSWSFFTHHQGSSWHGKDARLIFWMGGHWMLLTTAGFLLAGIVGFCLWWAYGRLLLCTS
RCFRYSPLSRRPPPPPSSPHCPSYSSTSRRNRLLQGWLRRPSPSKRQDEESGSRYTDIPY
ELVGRKSNVRNE

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	2.8e-23	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.22e-77	5	286	24	311	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.71e-24	76	157	4	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS66595.1|GT32	2.36e-226	1	372	1	379
QSS73535.1|GT32	9.61e-226	1	372	1	379
EAA57874.1|GT32	9.17e-181	1	366	1	354
AAP47108.1|GT32	9.17e-181	1	366	1	354
BCS17906.1|GT32	5.20e-178	1	365	1	354

PDB Hits     

PABG_06860-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	3.13e-100	1	279	1	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	3.78e-100	1	279	1	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	6.81e-86	48	284	46	283	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.37e-85	37	286	56	312	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	8.08e-55	59	266	64	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.629768	0.370238

TMHMM  Annotations     

Start	End
5	27
270	292