CAZyme Information: PABG_06841-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_06841-t30_1-p1
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		34412.74	6.1691

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

Full Sequence      

MTPATTMSNPGDFDAVRKDIVAELKKPGYDDGSAGPVFVRLAWHASGTYDKETDTGGSNG
AGMRYEGEGGDPANAGLEYARSFLEPVKRRHPWITYSDLWTLAGVVAIKAMGGPSIAWKP
GRTDFVDDSKLPPRGRLPDASQGTDHLRHVFYRMGFDDQEIVALSGAHTLGRTHMNRSGY
EGPWVNNPTRFSNQYFKLLTTLEWQPTTLSNGVKQFNYVDPDVSEDEKDQPLMMLPTDMA
LLSDPVFAKWVKVYSEDKEMFFSHFAKVFAKLLELGIRRDAQGRVINTDDTLGGYISAPK
KIDEPRARL

Enzyme Prediction     

No EC number prediction in PABG_06841-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	15	276	8.9e-59	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	7.47e-134	7	280	7	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	2.36e-84	33	276	29	243	L-ascorbate peroxidase
178467	PLN02879	1.49e-66	35	276	34	246	L-ascorbate peroxidase
166005	PLN02364	3.63e-65	33	276	31	246	L-ascorbate peroxidase 1
223453	KatG	2.13e-61	12	277	68	417	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73494.1|AA2	QSS73494.1|AA2	1.64e-206	7	309	5	307
QSS48707.1|AA2	QSS48707.1|AA2	6.68e-206	6	309	4	307
QKX59578.1|AA2	QKX59578.1|AA2	1.75e-183	7	305	1	299
QGA14796.1|AA2	QGA14796.1|AA2	1.49e-182	7	309	2	304
BCS24344.1|AA2	BCS24344.1|AA2	1.53e-173	7	305	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	1JCI_A	1.36e-73	12	277	18	274	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
1JDR_A	1JDR_A	3.08e-72	12	277	18	274	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
1STQ_A	1STQ_A	8.70e-72	12	277	18	274	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
4A71_A	4A71_A	2.62e-71	12	277	20	276	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	3M23_A	4.49e-71	12	277	15	271	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WLG9|CCPR2_ASPFU	sp|Q4WLG9|CCPR2_ASPFU	2.99e-176	7	305	1	297	Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_6G13570 PE=3 SV=1
sp|Q5B1Z0|CCPR2_EMENI	sp|Q5B1Z0|CCPR2_EMENI	1.33e-172	7	305	1	297	Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN5440 PE=3 SV=1
sp|A4R606|CCPR2_MAGO7	sp|A4R606|CCPR2_MAGO7	2.38e-156	8	309	3	300	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1
sp|Q4HWQ2|CCPR2_GIBZE	sp|Q4HWQ2|CCPR2_GIBZE	1.12e-152	8	307	14	309	Putative heme-binding peroxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRRES_10606 PE=3 SV=1
sp|Q4PD66|CCPR2_USTMA	sp|Q4PD66|CCPR2_USTMA	4.34e-145	7	307	1	300	Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PABG_06841-t30_1-p1.