CAZyme Information: PABG_06225-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_06225-t30_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		44071.21	4.2419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305541:358765-360243(+)

Full Sequence      

MYPSSVFPPPFISLNPDSGELGSGELESGEFLDPNYFQLSTYLPIYGNAVYYPNWRIYDG
KPPSSLSLGYVSHVFYAFAWVKEDGTVYLSDEYADEQIPVDGTYGCLNSLISLKWQFPEM
KVLLSIGGGGEGSQNFACVARNALSVEKFIETTTDLAVKFRLDGFDVNWEHPETPQEAAD
YFCLLARLREQFPSPDYLLTTAMAGAQWALQNINLTYIHQYVDFINLMAFDFAGHWMRQS
GHHAQLFTQQTNPYNADACIISGDSGVSYVLGQGVPAYKILLGIPVYGHAFPGTNGINQP
YEGPGGTELEEMVIDYCHLPHGGPEMHDDALGAAYCIDWTDDGGGEAGFVSYDSTKSVKF
KARYVKQKGLGGLFYWDIGADASGERSLVAAGYTELHEF

Enzyme Prediction     

No EC number prediction in PABG_06225-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	48	389	3.8e-63	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	1.93e-79	48	381	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	2.45e-79	49	381	3	334	Glyco_18 domain.
395573	Glyco_hydro_18	3.29e-68	49	381	3	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	2.15e-60	51	378	4	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
225862	ChiA	2.92e-57	46	391	38	431	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD87865.1|GH18	2.62e-135	43	398	26	368
UCK58594.1|GH18	2.62e-135	43	398	26	368
QQK40281.1|GH18	4.43e-135	33	398	16	363
UBR88483.1|GH18	5.63e-135	35	398	19	370
ACT90641.1|GH18	2.33e-134	43	398	33	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LL6_A	8.48e-63	48	389	5	356	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
1D2K_A	4.66e-62	48	389	5	356	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	1.29e-61	48	389	5	356	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
6IGY_A	4.04e-61	46	396	16	376	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
6EPB_A	4.28e-60	46	396	38	398	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CB51|CHI1_COCPS	1.49e-61	34	389	24	391	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	5.81e-61	48	389	40	391	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|C5P230|CHI1_COCP7	3.17e-60	48	389	40	391	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|E9ERT9|CHI1_METRA	8.15e-60	46	396	39	399	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|Q92222|CHIB_EMEND	8.40e-60	46	392	4	358	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999545	0.000472

TMHMM  Annotations     

There is no transmembrane helices in PABG_06225-t30_1-p1.