CAZyme Information: PABG_05683-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_05683-t30_1-p1
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	KN305539|CGC5	36149.65	7.4726

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305539:1029120-1030094(-)

Full Sequence      

MLPRQPFLFKFFTLISLILVGMISLFSYKNRTALTSRNATSFKSFLSSSSTSSKPIPQKI
WYKLGAKGISSKIQEWTATCISKNPTYVTEFLTDDSADEYVKVHFSHRPDIVDTYLSLPI
PILKADMLRYLLLIAEGGIWNDLDVSCGDIPIRDWIPEQFKKDANLVVGWEFDVGWGESI
IRQFTSWTIMARPGSKHLEMVVLDILDAIEKTKKKHKLAKTTELQMPMLGDIVDFTGPRR
LTSGIFKSLSEELGGEVNAGNASNLLSPKLLGDVLILPGFAFASSTNRYEGIKGPDGKDF
EPGPSLVTHHYAGSWRNEHGGEVV

Enzyme Prediction     

No EC number prediction in PABG_05683-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	158	1.2e-17	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.10e-19	55	194	81	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.04e-09	79	159	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK54761.1|GT32	1.21e-201	1	315	39	353
QQK44540.1|GT32	8.24e-105	56	322	59	317
CAE7002672.1|GT32	1.13e-101	49	324	65	334
CAE7026497.1|GT32	4.39e-98	56	322	52	311
CAP99443.1|GT32	1.51e-97	92	323	1	224

PDB Hits     

PABG_05683-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	9.59e-30	56	318	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	2.79e-27	53	318	96	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	5.46e-25	57	317	131	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.71e-15	52	205	92	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.96e-06	80	147	86	150	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998986	0.001042

TMHMM  Annotations     

Start	End
7	26