CAZyme Information: PABG_04249-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_04249-t30_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	KN305536|CGC7	25037.72	6.9321

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305536:469068-470017(-)

Full Sequence      

MATLFGIISMARILLTILNSGLVLTNPLPRPPPALVPRFTSPCPAVRIISARGTSEDPGE
GRLATVASDIAKGHENSERVPLDYPAELFPYSLSLHQGIRALKSLLNTTVSECPDSKIVV
MGYSQGAHVIGNTLCGGTITKAIDTVIGDKVTAIIFMADPRHVPGKPYDVGTATRGGLFA
RPDSESCDYFAPRLRAYCDSDDPVCDRGFDREVHRAVVGKYQADAVAFVNGLLN

Enzyme Prediction     

No EC number prediction in PABG_04249-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	42	230	1.1e-41	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.13e-41	42	233	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63080.1|CE5	4.23e-94	40	233	37	231
QVM10784.1|CE5	6.72e-54	28	230	18	225
AMW08145.1|CE5	9.92e-50	11	229	6	231
CDJ79836.1|CE5	3.55e-48	36	229	21	223
UAB99544.1|CE5	1.69e-46	32	229	31	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	1.84e-37	43	234	2	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	1.45e-36	43	233	2	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	1.45e-36	43	233	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	4.07e-36	43	233	2	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
7CY3_A	1.30e-10	41	206	15	165	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99034|AXE1_HYPJE	1.01e-35	43	234	33	238	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	1.52e-35	43	233	29	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	7.62e-33	43	234	25	230	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|O06319|CULP4_MYCTU	2.23e-11	33	229	37	222	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3
sp|P9WP39|CULP3_MYCTU	3.34e-11	39	229	40	222	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.510127	0.489859

TMHMM  Annotations     

There is no transmembrane helices in PABG_04249-t30_1-p1.