CAZyme Information: PABG_02974-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_02974-t30_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		51184.32	6.0600

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305534:844583-846155(-)

Full Sequence      

MKSQLWAVLATVVSFGPRAIVALNGSDLDSIESTKRAAAAVAQGAVKYYKGDQPGQTVGI
LPEPYFWWQSGAMLGTLVDYWHYTGDSTYNNLTKEGLLSQKGQQNDFQPASQLGILGNDD
QAMWALAALSAAEFSFDAPGSDQLQWVDLAKNTFEAQVRRWDNSKCGGGLNWQVNRNNNP
AASYKTSMANGAFFELSSRLARYTKNGTYLDWATKTWDWMSQVGFLTEDFKVFDGADAEG
DCKQLNHFQWSINVGILLSGAANLYNTTNDPTWKTRIEGLLKGADIFFSNNVMIEPACEA
NNRCMFDQKSFKGFLSRALGTTVKLAHFAKDIVLPKITASSRAAVEKCVNENGIQRCRFH
WLRKNNDTDHDRDESDGNNKTVGEQLATLQIILASLAGRGEGSSPITQPPPGKSQDDGKS
GRNSGGTPTSGAPSSSPSPGIASSVMDLSFQKWDAIIAVFGLSTMLGLVM

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	399	2.3e-92	0.9413407821229051

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.37e-142	47	389	15	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	6.92e-07	119	264	93	221	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAP74717.2|GH76	2.46e-275	1	417	1	418
ABF93408.1|GH76	2.46e-275	1	417	1	418
QSZ36627.1|GH76	4.81e-120	27	425	28	414
APA11655.1|GH76	9.62e-120	7	421	8	409
ATZ53339.1|GH76	8.72e-118	3	432	4	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.02e-90	28	396	30	403	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]
3K7X_A	2.58e-07	143	273	118	234	Chain A, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	7.62e-99	1	396	1	384	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	2.95e-93	27	397	22	383	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	2.12e-91	27	392	25	383	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|P36091|DCW1_YEAST	1.12e-90	27	433	25	418	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	1.58e-81	30	397	26	380	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001185	0.998763	CS pos: 22-23. Pr: 0.9428

TMHMM  Annotations     

There is no transmembrane helices in PABG_02974-t30_1-p1.