CAZyme Information: PABG_02075-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_02075-t30_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609		70376.33	7.0516

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305533:646592-648421(-)

Full Sequence      

MSHGTAGHQSGMRTQRLAVLLGIVCLVGITLMLLGNPAAQRIRQSTQRKKLFIPTSNHPE
ISDSQQKQQDQQQQTPEHPVHTENASKNLHPIVQLQNQAKEKFDDIRGRQSKTLKDAVGE
YRRRYKMPPPPHFDIWFKFAQQHDVQLIDEFDSIYHTLLPFWGLQPKLIRARAREAIGFD
NALISLLVRDGKVARIDGGGESREWQRIALEGMLKSFVQYLPDMDLAFNIHDEPRVVIPS
EDLQRLVVRAMDGALPRALENPSPNNSWSGRPDDVNKGDRIDEFRTTRFNRFAHQPTWTN
SRMSCPVDSPARNLDENAPDNIKAFSNTELGFLYNITAFTDICLSPSLQHTFGFFDRPNA
LDLVHDLFPIFSQSKVSSFQDIIYPSPWYWAGKVPYDAGKDVAWYDKLEQLYWRGSTTGG
FSRAGGWRRQHRQRFIKEINGWDSAKIYEKNTDSGVWELKEVARHALKDLFNVKFSHVGQ
CDPEDCKAQSEFFDVVESADQQDAWKYRHLVDIDGNAFSGRYYAFLRSNSLVYKLALFRE
WHDEWLRAWVHYVPLSLKGDEHVETVRFFALDDEGREIAQLLANQGKEWAGKALRNNDLE
VWFFRLLLE

Enzyme Prediction     

No EC number prediction in PABG_02075-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	346	609	1.3e-76	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.97e-15	365	609	28	248	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.67e-05	369	609	108	318	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS70518.1|GT90	2.75e-317	9	609	4	608
QSS52524.1|GT90	5.55e-317	12	609	1	602
QSS64625.1|GT90	8.65e-312	9	609	128	727
BCR83603.1|GT90	4.24e-272	87	609	63	584
QKX56622.1|GT90	4.41e-271	12	609	298	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.95e-07	369	607	154	372	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	5.24e-07	346	609	95	337	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	8.19e-47	84	609	141	651	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	7.61e-07	369	607	164	382	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.03e-06	369	607	166	384	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.01e-06	346	609	123	365	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	3.98e-06	346	609	123	365	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000005

TMHMM  Annotations     

Start	End
17	39