CAZyme Information: PABG_01132-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_01132-t30_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		43760.26	9.6236

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305532:399708-400877(-)

Full Sequence      

MYRASSRRRPPIRLSRLRLLVSASISLYLFCFTIFGTNNNWIRKPYAPLQTFIKLKKRLT
WSLRRSSTDQAQLQIPRSQPVPDPDVPCIPGLPNIPAKIWQSAKSENLSMKQKAWSSTWL
EKNPSFEHELVTDDTWNQYVEKKYGTIRPDIVSLFKGLQVAILKADLLRYLILLADGGIW
SDIDATCAMPVADWLPADANDVMFAGGNVTSHTPWSEGIGLIVGLEFDGEWEGEGSGLSS
QLTNWVFAARPGSRHLQLVVDDIVRHLNDITLENGVTAEGITLDMISDVVEVTGPWRMTL
GILESLSCMLGRRVDERDFSRGKKPRVLGDVVIMPGNAFAAKQNGYPTGQGPVLVTHHYE
GSWKSLARQAKDRRRRKMMETEARRKTAD

Enzyme Prediction     

No EC number prediction in PABG_01132-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	196	3.9e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.93e-19	24	197	12	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.71e-10	118	196	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14453.1|GT32	7.58e-94	98	377	101	365
BCS02801.1|GT32	2.16e-93	98	377	135	399
CAK46331.1|GT32	7.40e-92	98	377	149	413
QKX62870.1|GT32	3.27e-90	95	376	110	376
QQK48128.1|GT32	1.78e-85	94	377	85	353

PDB Hits     

PABG_01132-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.80e-21	96	364	100	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.75e-18	89	364	136	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.44e-17	96	339	131	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.76e-15	53	263	62	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000011

TMHMM  Annotations     

Start	End
20	42