CAZyme Information: PABG_00450-t30_1-p1

Basic Information

• Species: Paracoccidioides brasiliensis
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides brasiliensis
• CAZyme ID: PABG_00450-t30_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302	KN305531|CGC3	32778.06	5.2220

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PbrasiliensisPb03	8548	482561	121	8427

• Gene Location: location=KN305531:1603755-1605031(+)

Full Sequence      

MRLSTFLSLILASSPALVSAAGTLGFCLGVKNADGTCKSRKDFEDDFDVLMAHTKIVRTY
AAADCNNAEAILPAAKSKGFKVVLGIWPDVEESFNADTKAIQKAIPGHEDVIAAITVGSE
TLYRGNFTGEELLSKINTVKKMFPKVKVGTADSWNKYNDGTADALIKGGVDYFLVNAFAF
WQGKAAQDATETLLDDMARAVSHIQLLAGSRAKDIYIATGETGWPSDGGSDYEDAKAGTA
NAKIFHDKGVCALLRWNVDVFFFEAFDEPWKPKSVGDNGYAADETHWGLYTADRKPKYEV
KC

Enzyme Prediction     

No EC number prediction in PABG_00450-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	24	302	6.9e-41	0.9967845659163987

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.46e-73	12	294	34	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.03e-46	24	302	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS49555.1|GH17	7.18e-175	1	302	1	302
QSS68032.1|GH17	4.15e-174	1	302	1	302
QSS60378.1|GH17	1.69e-173	1	302	1	302
EER28012.1|GH17	2.06e-168	1	302	1	301
QVM12021.1|GH17	1.69e-167	1	302	1	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.13e-36	34	297	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.11e-36	34	297	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	3.01e-06	213	298	299	381	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.08e-152	1	302	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	2.99e-73	11	302	9	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.69e-72	11	302	9	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	2.78e-72	18	302	21	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	1.62e-64	11	302	29	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999746	CS pos: 20-21. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in PABG_00450-t30_1-p1.