CAZyme Information: PAAG_08259-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_08259-t30_1-p1
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		54191.19	6.7769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN294022:124255-125703(+)

Full Sequence      

MVQGPRYRRTFPLVLIALFLYFTLRRTVSSSSADNDSSESIQNGIPTTAKHGEFWVTFHE
ILKAAEPHCKSPRRIEDHPAAIGFKPDQIENVTLPEHIIVDREDREILKKAHLLFTSFLS
DSTAPRLQYTPGTKGIVSTAGGKYLPVLVTSLHMLRKTGSDLPAEIFVADKSEYDEYVCG
VLLPSMNAKCVILAEILDFSPLDEGLKKYQFKIFSLLFSSFEQVLFLDADAFPMHNPIHL
FDSDPFISTGMVTWPDFWQVTYHPSFFEVSSQKVPTGFSHASTESGQVLVSKKSHAKMLL
LSAYYNFYGPSHYYLLLSQGHPGEGDKETFIAPAMILNLPFYAVSTGPAVFGYRKPNGDW
EGGVILQVNPIWDFKIPKGKVYGWSDKPSSPPESFITCHANLPKLDPMSVFGEKGLAWDG
EGKPQRMWGPAREMIAKVGFDIERRLWGELRTTACEMEGKFQPWNDKPKLCEKIGQFMAQ
IG

Enzyme Prediction     

No EC number prediction in PAAG_08259-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	134	368	2.5e-67	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.24e-68	134	365	2	264	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	3.89e-04	139	256	7	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS75167.1|GT71	1.65e-295	1	481	1	484
QSS59139.1|GT71	1.83e-292	1	481	1	484
QSS54189.1|GT71	1.06e-291	1	481	1	484
CAK42262.1|GT71	5.87e-126	48	477	55	480
QMW28120.1|GT71	6.43e-126	3	481	7	470

PDB Hits     

PAAG_08259-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	5.72e-62	94	474	209	645	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	1.15e-53	99	481	140	601	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|P46982|MNN5_YEAST	5.41e-49	105	467	117	554	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	7.06e-49	84	374	236	563	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q5A687|MNN22_CANAL	1.08e-48	122	417	151	496	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.123853	0.876148	CS pos: 30-31. Pr: 0.8285

TMHMM  Annotations     

There is no transmembrane helices in PAAG_08259-t30_1-p1.