CAZyme Information: PAAG_06857-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_06857-t30_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		43217.60	8.1284

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN294011:459359-460522(-)

Full Sequence      

MYRAYSRRRPPIRLSRLLLLVSASISLYLFCFTIFGTNSKWIGEPYAPLQTFKLKETDLE
LRRSSTDQAQLQIPRSQPVPDPGVPCIPGLPNIPAKIWQSAKSENLSTKQKAWASTWLEK
NPSFEHELVTDETWNQYVEKKYGAIRPDIVSLFKGLQVAILKADLLRYLILLADGGIWSD
IDATCAMPVADWLPADANDVMFAGGNVTSHTPWSEGIGLIVGLEFDGEWEGEGSGLSSQL
TNWVFAARPGSRHLQLVVDDIVRNLNDIALENGVTAEGITLDMISDVVEVTGPWRMTLGI
LESLSCMLGRRIDERDFSRGKKPRVLGDVVVMPGNAFAAKQNGYPTGQGPVLVTHHYEGS
WKVLARQAKHRRKRKMMETEARRKTAD

Enzyme Prediction     

No EC number prediction in PAAG_06857-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	112	194	5.7e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	7.37e-22	24	195	12	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.05e-09	116	194	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14453.1|GT32	6.26e-95	96	375	101	365
BCS02801.1|GT32	1.79e-94	96	375	135	399
CAK46331.1|GT32	1.23e-92	96	375	149	413
QKX62870.1|GT32	3.42e-92	93	374	110	376
QQK48128.1|GT32	1.48e-86	92	375	85	353

PDB Hits     

PAAG_06857-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	4.68e-21	38	362	59	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	3.13e-18	87	362	136	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.31e-17	94	337	131	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.36e-14	93	261	96	282	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

Start	End
17	39