CAZyme Information: PAAG_05983-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_05983-t30_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	KN294007|CGC4	40652.85	9.4971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN294007:482470-483564(+)

Full Sequence      

MFSFLQSTLNVISIALITSAYLPPTLSCQQNPGRRRNKMLPRQPSMFKLFTLISLILVGT
ISIFSYKNRTALTSRNVTSFKNFLSSPSTSSKPIPEKIWYKLGAKGISPKIQEWTATCIS
KNPTYVTEFLTDDSADEYVKIHFSHRPDIVDTYLSLPIPILKADMLRYLLLIAEGGVWND
LDITCGDIPIRDWIPEQFKKDANLVVGWEFDVGWGESFIRQFTSWTIMARPGSKHLEMVV
HDILDAIDKTKKKHKLPKTTGLQLQMLGDIVDYTGPRRLTRSIFKSLSEDLGGEVNAGNA
SNLLSPKLLGDVLILPGFSFASSTNKYEGVKGPDGKDFVPGPSLVTHHYAGSWRNEHGGE
VKGN

Enzyme Prediction     

No EC number prediction in PAAG_05983-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	111	196	1.6e-17	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.67e-19	50	247	22	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.68e-09	117	197	10	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK54761.1|GT32	7.78e-252	1	353	1	353
QQK44540.1|GT32	4.56e-107	94	360	59	317
CAP99443.1|GT32	9.26e-99	130	361	1	224
CAE7026497.1|GT32	1.56e-98	94	360	52	311
CAE7002672.1|GT32	6.88e-98	90	361	68	333

PDB Hits     

PAAG_05983-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	9.81e-30	87	356	92	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.52e-28	94	356	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.43e-27	87	355	123	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.45e-14	87	328	89	363	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.80e-06	86	185	45	143	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000013

TMHMM  Annotations     

Start	End
4	26
47	66