CAZyme Information: PAAG_05770-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_05770-t30_1-p1
• CAZy Family: GH76
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		45577.77	9.8836

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN294006:823288-824614(+)

Full Sequence      

MNLSSLNLALASCVLAWVSLASASSHVTSHIVPRQAKSAIYGVNLGGWLLLEPWITPSVF
EAGGSSAVDEYTLSKNLGSNAKTRLSKHWSTFITADDFKQIAAAGLTHVRIPIGYWAVSP
IKGEPYVQGQVEYLDKALVWAKNSNLKVVIDLHGAPGSQNGFDNSGRRGPINWQKGDTVK
QTLAAIRALANRYAKRTDVVNSIELVNEPFVPGGVQLDPLRKFYKDGYAIVRGVDSTVGV
AISDGFQPPRSWNGFMAPKDFKNVHLDTHHYQVFDDAFKTFTIDQHVKLACSLPKDRLSG
VDKPLIVGEWSGAMTDCAKYLNGRGRGARFDNSYPSGKPSGACGARSTGSSSKLSAQQKK
DTRRYIEAQLDAFKVGAGWFFWTWKTEGAPGWDMRDLLKQELFPQPFSARKYGGCK

Enzyme Prediction     

No EC number prediction in PAAG_05770-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	87	387	1.8e-116	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.75e-69	40	414	18	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.05e-12	89	312	19	238	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAG36698.1|GH5_9	1.36e-257	1	416	1	416
AAC49253.2|GH5_9	1.36e-257	1	416	1	416
QSS61799.1|GH5_9	1.73e-216	2	416	3	416
QSS56663.1|GH5_9	4.05e-215	3	416	4	416
QSS71511.1|GH5_9	3.31e-214	3	416	4	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	5.70e-115	37	412	6	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.14e-114	37	412	6	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.39e-114	37	412	12	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	3.93e-114	37	412	12	393	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	3.93e-114	37	412	12	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	1.80e-161	18	412	13	411	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|D4AJL7|EXG1_ARTBC	1.76e-158	33	414	27	410	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1
sp|Q5B5X8|EXGA_EMENI	5.39e-158	40	412	29	399	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	5.56e-158	25	412	27	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	7.88e-158	25	412	27	411	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000337	0.999659	CS pos: 23-24. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in PAAG_05770-t30_1-p1.