CAZyme Information: PAAG_05407-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_05407-t30_1-p1
• CAZy Family: GH71
• CAZyme Description: mannosyl-oligosaccharide alpha-1,2-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	KN294005|CGC1	57393.28	9.2166

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN294005:469233-471329(+)

Full Sequence      

MRRFFGFALTALSLVPFTISFPLLPDDKYGPLEKRAPNSKRAKAVKEAFEFAWSGYMKHA
FPHDELRPVSNTPSDSRNGWGATAVDALSTAIIMDSPEIVKTILEHISKIDYSKTNSGVN
LFETTIRYLGGMLSGYDLLSENNMGQNPDHIKALLTQSKKLADVLKYAFNTPSGIPSNNL
IIGDQLTDGGTSNGIATIGTLILEWMHLSDLTGDPEYGRLAEKGESYLLKPKTAGAEPFP
GLIGSELNTTTGHFLNSDISWGAGSDSFYEYLIKMFIYDESRFKTYRDRWVLAIESSIKH
LKVLLPLRPEFTFLAPYSNKKLGSSSQHLACFNGGNFLLGGQVLNRQDFVKFGLDLVKGC
RHTYSSTATKIGPEGFSWDKSRVPKGQRSFYIKNGFFITSKDYNLRPEVIESYYHAYRIT
GDIKYQDWVWEAFEALVRTCRTDSGFSAISNVNTLDGRKKKNFQESFLFAEVMKYAYMTF
APEASWQVAREGKNKFVFNTEAHPLKVRTKG

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	48	507	1.2e-128	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	48	507	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.12e-119	38	507	69	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS65278.1|GH47	1.96e-258	2	511	3	513
ABA54911.1|GH47	4.35e-224	11	511	13	518
ABB36773.3|GH47|3.2.1.113	1.24e-223	11	511	13	518
BAA08275.1|GH47|3.2.1.113	1.67e-219	1	507	1	508
CAP94087.1|GH47	2.34e-214	12	507	12	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	5.76e-221	1	507	1	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	7.02e-218	38	507	2	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	9.63e-158	33	509	7	494	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	4.66e-64	32	507	9	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	5.78e-64	32	507	7	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9CXX8|MNS1B_COCPS	2.21e-224	11	511	13	518	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|P31723|MAN12_PENCI	2.97e-220	1	507	1	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q0D076|MNS1B_ASPTN	3.96e-210	9	508	10	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|B8N417|MNS1B_ASPFN	1.72e-209	9	507	10	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	1.72e-209	9	507	10	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000973	0.999001	CS pos: 20-21. Pr: 0.9607

TMHMM  Annotations     

There is no transmembrane helices in PAAG_05407-t30_1-p1.