CAZyme Information: PAAG_02443-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_02443-t30_1-p1
• CAZy Family: GH13
• CAZyme Description: mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		46279.73	10.1231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN293996:868102-869512(-)

Full Sequence      

MNIYERAINVATNPKHSKWISSLLLIADIFLCALIVWKVPYTEIDWTTYMQQVSLFLSGE
RDYALIKGSTGPLVYPAGHVYVYSALYYLCDGGRDIFFAQALFSILYLATLVIVMWSYRF
VKAPPYLFPLLVLSKRLHSVFLLRLFNDGVATFFLWAGIFALQRRRWSAGVILWSMGVGV
KMTLLLVAPAVAVIAVLGVGILRAAGLGATALWLQVLFALPFLKENPSSYISRSFEFTRQ
FLFRWTVNWRFVGEKVFTSNAFAVALLAVHASLLGLFLIFCWIRPLTTSPEQLIKNIVRG
RQLPIQIVNSFIMTTMLSSLAIGLLCARSLHYQFFAYLSWATPYLLWKSGFHPVITYLVW
AAQEWAWNVYPSTTASSITVVSGLSIQVFGVFWNGYRMRFSNKEHKE

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	23	377	2e-140	0.9917582417582418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	22	377	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72893.1|GT58	1.68e-221	1	407	1	407
QSS55330.1|GT58	2.78e-220	1	407	1	407
QSS65569.1|GT58	1.17e-185	50	395	1	346
BCR98022.1|GT58	4.98e-175	9	405	9	411
BCS10476.1|GT58	4.98e-175	9	405	9	411

PDB Hits     

PAAG_02443-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U6A4|ALG3_ASPOR	4.14e-174	13	394	13	394	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	6.43e-170	1	407	9	419	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	7.10e-165	9	407	71	469	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	6.22e-161	1	405	1	409	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	8.45e-151	13	407	13	409	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000003

TMHMM  Annotations     

Start	End
19	41
72	89
96	118
140	162
169	191
201	223
261	283
303	325
337	359
374	396