CAZyme Information: PAAG_01372-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_01372-t30_1-p1
• CAZy Family: AA7
• CAZyme Description: beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925		101298.18	6.7722

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN293994:164929-168131(+)

Full Sequence      

MREFDYRQMGQLFVMGFDGTSVNSEIRSLIEDYHLGSVILTAKNLKSAEETTKLVYELQS
IARNAGHPVPLMICLDQENGGVNSLFDEIYIRQFPSAMGMAATGSKSLAREVSKATAQEL
SAVGINWILGPVLDALTNARNQPLGVRSVGDDPQEVSAYGIEFMKGYQDAGLVTCGKHFP
SYGNLDYMGSQSDVPIITDSIEQLSVSALVPYRSAITNGIDSMMVGGCAMSSAGMTVMHA
CLSEQVVDDLLRKDLKFDGVVVSECLEMEALSYNIGVRGGTVMAMKAGCDIILLCRSFSI
QQEAINGLKVGVENGMISKSRIRESLRRVLDMKSRCTSWEKALNPQGISLLSRMQPSHTS
LSTKAYNSSLTVVRDKHNYLPLTSILEPDEELLLLTPLVKPLPASATLLSIVTENSNRPS
LSTDAVSWERNASVMSGESVFREFGRSLARQRNGRVLHTSYTANGVRPVHENLIDRASAV
IIVTADANRNLYQNGFTKHVSLICNSQFSPSGERRAKPVVVVAVSSPYDFATDQSIGTYI
CTYDFTETALQTLVKILYGELVPTGSLPGSLSRNQRLQQSRQHWLVENWNEDRDTHALDS
LLNIVREDVTQGQRSELFSVTSSTLLLRNNDVEESHFVVRNSSTHSLYGFCSTYYFKSTG
TGVIGALIVDPSRRRMSIGHSLHNRAIRTLIQRPGIRSFQLGARLPGIYLGIPTGNPVER
KRLRQWFANLGWNTALSRSVCSMVLRNLENWTPPEGLTKILQSSDVDYDLVYGWEYADSV
LDHVKTTSRVGVMELYKRGLSGAPGSGIIRAKRREDGTILGSVVVYNSTSTLAEAMPALR
ETHAISGAISSPVISPSVGEYATLVQGLILLGIKQIRKQGASAAVLDCVDGDGNYDSLSS
MGFSVLHSFDEVTCDVSNWNMMSAS

Enzyme Prediction     

No EC number prediction in PAAG_01372-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	293	8.2e-52	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.78e-70	8	383	6	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.66e-68	10	330	7	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	7.44e-30	9	295	1	280	beta-hexosaminidase; Provisional
185053	PRK15098	5.47e-10	93	333	119	353	beta-glucosidase BglX.
178629	PLN03080	5.03e-09	94	382	114	415	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	1	925	1	924
QSS74235.1|GH3	0.0	98	925	1	827
QSS50503.1|GH3	0.0	98	925	1	827
BAE65506.1|GH3	0.0	7	925	46	961
QMW48185.1|GH3	0.0	7	925	17	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.10e-86	7	755	11	700	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.25e-60	7	572	15	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.06e-44	20	568	71	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.38e-44	20	568	45	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.07e-44	20	568	75	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	5.47e-44	20	568	71	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	1.87e-35	8	383	31	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	2.86e-30	20	568	49	593	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	3.08e-27	19	310	12	298	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q6LJ30|NAGZ_PHOPR	8.73e-27	9	308	1	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PAAG_01372-t30_1-p1.