CAZyme Information: PAAG_00543-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_00543-t30_1-p1
• CAZy Family: AA3
• CAZyme Description: alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	KN293992|CGC7	22038.92	4.9842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN293992:1911631-1912258(-)

Full Sequence      

MYGLKRIFHNLPLHLPNGLTNEPRGLGWIIIDSLDPMTLMNRTSRLGNAQTFDPIKSHTT
SRILGRVSYVSSPQDSVYLSNAIDLADRLLDAYEFPSGIPYAGIELRTKNGIRSHADGGA
SSMTEVTTLQLEMKYLANFTGNELYWLKAEKVDQILDDNVMGDGLHPIFVDPESDDHFTT
PTDIMGRIYYTTISTNI

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	23	177	1e-26	0.3811659192825112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.34e-38	19	174	22	199	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	4.43e-23	25	174	109	273	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS59484.1|GH47	4.42e-56	18	180	96	278
QSS74749.1|GH47	5.17e-56	18	180	96	278
QSS54594.1|GH47	5.43e-55	18	180	96	278
UQC83563.1|GH47	1.64e-44	7	180	111	301
AEO63634.1|GH47	2.12e-43	18	186	100	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DL2_A	1.41e-25	21	174	39	227	Crystal Structure Of Class I Alpha-1,2-mannosidase From Saccharomyces Cerevisiae At 1.54 Angstrom Resolution [Saccharomyces cerevisiae]
1G6I_A	1.60e-25	21	174	73	261	Crystal structure of the yeast alpha-1,2-mannosidase with bound 1-deoxymannojirimycin at 1.59 A resolution [Saccharomyces cerevisiae]
5KIJ_A	1.05e-12	25	174	42	203	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.06e-12	25	174	47	208	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.06e-12	25	174	47	208	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0Q0|MNS1_CANAX	7.27e-34	23	174	75	238	Mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Candida albicans OX=5476 GN=MNS1 PE=3 SV=2
sp|P32906|MNS1_YEAST	8.34e-25	21	174	72	260	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNS1 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	3.87e-19	20	190	130	315	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q9P7C3|MNS1_SCHPO	9.33e-19	24	170	84	244	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
sp|Q8H116|MNS2_ARATH	1.15e-17	25	174	136	297	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000003

TMHMM  Annotations     

There is no transmembrane helices in PAAG_00543-t30_1-p1.