CAZyme Information: PAAG_00495-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_00495-t30_1-p1
• CAZy Family: AA3
• CAZyme Description: dolichyl-phosphate beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555		61214.20	8.4684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN293992:1768234-1770496(-)

Full Sequence      

MRALEQSRSDEGHLQNTVPSGSFWNSQLSFSRQLEFWEQVINLSRSLRHESRSQQKYFNY
ADTSRKVEVVLECPSDIKAARAQYHVLQNRKKLLFCAGQSPIVEMSPSNPALLGLPLGDA
VECWLKTTAILIIYQASQTKQAMDIAALRAICDRCIQLASNAPLSLWFIFLLSTLTGAIL
TGYTLLFIVAPSPRPPLPQEKNYKTISEDGSITEPLLLPCWQDSQGASPANDAKAIEKAE
LFMSVVVPAYNEEDRLGGMLVEAVNYLEKTYGILSEQQQSKPLSREEAESGGTRFRKHNE
NESIRAAPPSKGWEILIVSDGSTDSTVATALAFARDHQLSPHSKSHIGPWTTASNAKVVP
IPPGSIRVITLAQNRGKGGAVTHGMRHVRGQYVIFADADGASRFDDLGKLVAACQRVEDA
SSRGIAVGSRAHLVGSEAVVKRSKLRNFLMHSFHLILRILTPPATAAIKDTQCGFKLFSR
ASLPYIIPHMHSEGWIFDVEMLMLAEFSGIPVVEVPVGWREVKGSKLNVIWDSFGMAWGL
AVLRAAWGFGVYRMN

Enzyme Prediction     

No EC number prediction in PAAG_00495-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	244	437	2.6e-22	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133031	DPG_synthase	5.68e-89	245	526	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
240336	PTZ00260	5.88e-83	162	555	10	324	dolichyl-phosphate beta-glucosyltransferase; Provisional
133022	DPM_DPG-synthase_like	9.12e-45	245	505	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	4.41e-23	244	483	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133062	DPM1_like	1.59e-21	245	540	1	224	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS59528.1|GT2	1.11e-222	143	553	2	416
QSS54535.1|GT2	4.01e-219	143	553	2	420
AAF01464.1|GT2	4.24e-217	158	553	5	404
QVM11118.1|GT2	6.57e-192	143	553	1	412
QMW32160.1|GT2	4.39e-185	151	553	9	413

PDB Hits     

PAAG_00495-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40350|ALG5_YEAST	1.80e-74	175	555	19	331	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|O60061|ALG5_SCHPO	8.08e-72	180	553	11	314	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|Q9VLQ1|ALG5_DROME	2.49e-54	170	554	11	318	Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=wol PE=1 SV=1
sp|Q54J42|ALG5_DICDI	3.90e-51	241	555	74	326	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
sp|Q9Y673|ALG5_HUMAN	5.34e-47	243	555	67	318	Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

Start	End
164	186