CAZyme Information: PAAG_00249-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_00249-t30_1-p1
• CAZy Family: AA2
• CAZyme Description: endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
941	KN293992|CGC1	103643.00	8.1725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN293992:912393-915462(+)

Full Sequence      

MLLMAMQCLPGVRAFRCHSGFNCPCDNVDVDIPSFSLVTQFPPTGVQPQVTRTPGVYHTE
LEKDVRDSMQPFPTGISYVVFDDHIGLPHPEYPHLDIVPSKVLYSNSACYYKGNWCPGLP
HVEENRISSWLLDQSTRSPTKFATATSSKVRSGSPYHSSLYLAPSSTSRSPPRGTAIVHP
SGTAGHSQTSEISTNIPHPTPTSMSHQDIFEPIDKGPIPSNINSRSDHPVQKDHISDTPG
PISTNKFYANFFLGSQTGYAFVHPYAVGWAKGTGNAKSYGVLISHIESHQLAFGPKSQSI
PGNPVQFYINPIGIQSMILSASELGTSTVLTVSKANAFSADIILRPNRGSNSTIIFPLVQ
GMGYVTGLYMSLQPAIQSSVFFRKLESVASPKPGIYKYRVTLEDNTHWLIYVTPTGNGGN
PNLVLVSNTLISGPTGFSGIIQVAKNPNGSAGEAIYDRTTGVYPTEAHISGSVVAHQAMG
TYKLTWQKAGKNVNSTPLLMFALPHHVQSFDTHTQHMKTDMFLRTTTKGNATACVGNSWT
MVEKNLPVNIGFGPWNPNTGTEATLSNATKQRIRHVAPSELSQDISRQTNLNSMYFSGKA
LNKFAMLVYTVYELVKDASLSESAFSSLKSAFARFVDNRQIFPLVYDTVWKGVVSSGTYV
TGDPGLDFGNTFYNDHHFHYGYFILAAAIIGYLDPSWVVANKGWVNTLVRDAGNSVSNDD
YFPFSRAFDWYSGHSWAKGLFESFDSKDEESSSEDAMFAYAIKMWGKVIKDRSMEARGNM
MLAILSRSFNNYVLMKSDNVNQPSNFIANKVTGILFENKADHTTYFGTNLEYIQGIHMLP
LIPSSPYIRGKGFVSEEWNAMFAENASTPASGVQGGWQGILYANLAIIDPNASWNFFNKE
PFDLSKIDGGATRTWYLAFAAGRFYPMVIPKRTSRSFFRDM

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	228	919	2.4e-223	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	189	922	27	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	564	917	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	3.78e-150	228	557	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67487.1|GH81	0.0	204	922	128	845
QSS66079.1|GH81	0.0	196	922	122	847
QSS57493.1|GH81	0.0	204	922	128	845
ABH10633.1|GH81	0.0	204	921	1	712
CAP93568.1|GH81	0.0	201	925	174	893

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.58e-101	208	923	7	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.02e-101	192	923	15	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.61e-97	208	923	7	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.52e-25	595	900	340	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.02e-18	674	910	439	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	71	924	74	903	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.61e-184	208	922	2	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.96e-165	209	922	47	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	4.01e-157	219	922	411	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.09e-156	208	922	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.025032	0.974922	CS pos: 14-15. Pr: 0.9234

TMHMM  Annotations     

There is no transmembrane helices in PAAG_00249-t30_1-p1.