CAZyme Information: PAAG_00176-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_00176-t30_1-p1
• CAZy Family: AA11
• CAZyme Description: glycosyl transferase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	KN293992|CGC6	55238.89	6.8832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN293992:663542-665313(-)

Full Sequence      

MVHGAVSPRVSTQQAAESSSRLAKSRDRLGIDRSDAIPERERICFTPRVKRERYLQAEKE
DVLHCGADVLLIRSMLKLTLLTSFLREYVAVGCLSTLSVGDFDNSSPASPWLLTTPIECH
LFREHGRCERRNDTTTTPCLVFIQSPLILLSASARTAHSTHIEIIMGNPVLVTSPAPRPA
HKKVWTTLITNTAYLSGLLTLDYSLKKVGSKYPLVALYTDSFPPDGHLALQARGIPSRHV
PYLLPAIHKDYSNDIRFYDCWSKLTPFSLVEYDRVVQLDSDMLVLRNMDELMDLELDDPE
LKGDGSRVFAATHACVCNPLKKPHYPKDWIPSNCALTTQHADPTSAQTQGAPSTTGLGAL
NGGLQVVNPCSSIYDKILTILQTPSATSTYEFADQSLLSDLFPGRWVPLPYIYNALRTLR
WEGVHSEIWKDGNVKNVHYILNPKPWDGKWDGERVWDGERDDKNAVTDGWWWRANRERLE
EEKKAGIVADGF

Enzyme Prediction     

No EC number prediction in PAAG_00176-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	181	447	7.7e-40	0.8832684824902723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.47e-66	184	478	2	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	8.35e-18	186	471	27	288	galactinol synthase
133037	GT8_A4GalT_like	4.00e-10	249	446	53	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	1.28e-08	194	446	10	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133064	GT8_GNT1	2.11e-08	189	291	7	111	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS57188.1|GT8	2.86e-184	173	487	9	316
QSS61250.1|GT8	8.76e-182	125	488	29	398
QSS72023.1|GT8	1.85e-175	173	487	9	316
CAK40859.1|GT8	1.78e-159	183	492	15	320
BCS16669.1|GT8	2.37e-157	183	487	15	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	5.72e-12	182	456	7	252	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
1ZCT_A	8.80e-07	177	451	16	245	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V8Y_A	8.85e-07	177	451	16	245	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]
1LL0_A	1.11e-06	177	451	2	231	Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_B Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_C Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_D Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_E Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_F Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_G Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_H Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_I Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_J Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus]
3USR_A	1.18e-06	177	451	16	245	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O22693|GOLS4_ARATH	1.66e-20	165	490	5	306	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1
sp|Q947G8|GOLS1_SOLLC	1.50e-19	186	488	24	292	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|O22893|GOLS1_ARATH	5.22e-19	175	488	23	313	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1
sp|Q9XGN4|GOLS1_AJURE	2.05e-18	180	490	21	307	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O80518|GOLS3_ARATH	5.09e-18	182	480	15	291	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PAAG_00176-t30_1-p1.