CAZyme Information: PAAG_00091-t30_1-p1

Basic Information

• Species: Paracoccidioides lutzii
• Lineage: Ascomycota; Eurotiomycetes; ; NA; Paracoccidioides; Paracoccidioides lutzii
• CAZyme ID: PAAG_00091-t30_1-p1
• CAZy Family: AA1
• CAZyme Description: beta-glucan synthesis-associated protein KRE6

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	KN293992|CGC2	72341.69	4.9766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PlutziiPb01	8953	502779	127	8826

• Gene Location: location=KN293992:352905-355307(+)

Full Sequence      

MPQNHLHKQPPPPKIKTSSREGQKDPFQDPSPPSCYLITPPQPPYSPAYQQGSSFQTNDS
SDHLAPPHYSRRYQTDKDVSMGYSNFSSRRTSWSSEGGSWESRGHLLNSSGKYWDHSRVS
SVAEDEINTQTVVEKYAIMPDYDNLLVYPEDVEKDDYLHNPDPSDSDRDCEVCSRRGVLN
IAGLIIVLLGAMTLFIIYPLLTFFDKLKEGEKPTCADDSLCLDVGPIPHLQNIRTSLIDP
DTPQSVRSITSSSGKQWKLVFSDEFNKDGRTFYEGDDPFFQAVDIWYGVTEDLEWYDPDA
ITTRNGKLEIRFDAFKNHGLDYRSGMLQSWNKLCFTGGRLEASISLPGRGDTSGFWPGFW
TMGNLGRPGYAATTEGMWPYSYDDICDAGITPNQSSTDGISWLPGMRLPACTCKGEDHPN
PGKSRSAPEIDVIEASVHALDPKLPSTIGDVSQSVQVAPFDVWYMPNFEFYELYNPSITS
INNYRGGTYQQAVSGITNINNKWYDGKEYQVYAFEYKPGKNGEISWFVGADKTWKLDARA
LGPNGNVGQRIIPVEPMALILNFGMSKTFAPLNLTGLAKLMPATMRFDYVRIYQDPDKES
VTCDPTGYETTRYIRTHQDAYNNPNKTRWCGANALSVAQKFIHA

Enzyme Prediction     

No EC number prediction in PAAG_00091-t30_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	263	593	1.1e-152	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	145	629	1	484	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.09e-169	259	594	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	4.05e-69	225	607	17	355	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	1.49e-18	261	593	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	2.53e-04	257	379	2	126	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72113.1|GH16_2	0.0	17	643	21	642
QSS57285.1|GH16_2	0.0	72	643	74	643
BAE59904.1|GH16_2	1.70e-275	13	643	14	655
QRD86509.1|GH16_2	1.70e-275	13	643	14	655
QMW42142.1|GH16_2	1.70e-275	13	643	14	655

PDB Hits     

PAAG_00091-t30_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P87024|SKN1_CANAX	3.46e-173	150	629	243	722	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P32486|KRE6_YEAST	9.20e-172	150	629	214	695	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|O13941|YEPB_SCHPO	2.17e-166	153	629	132	611	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P33336|SKN1_YEAST	1.71e-161	150	629	254	747	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87023|KRE6_CANAX	4.80e-159	150	627	240	723	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
178	200