CAZyme Information: P175DRAFT_087860-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_087860-t39_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		46904.28	7.2708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:6243227-6244723(+)

Full Sequence      

MRSPRRLRRVVALAVALVLFLTLLLHWRTNNPRFAPTKYPLLARYVTDRRRDGGVWYLPP
EWTRGSGISPSNIVEAAECALNLSRSTAQRQLPHSTIPLILHQTWKNTNPETWPDMFRQS
TEKWLGAVEDSTMAYFLWDDDGIAQFIKSFEPGLEDQFYALPSSVERSDVFRILVSKWIG
GIYGDMDTEPIRSPTDWITSTDILSWRDPETGHMYNSTEPVQAIVGLEADCSPDTDLYWR
MGYTYPVQLTQWSFAWTPRHPILQLFLDHLFMTLHIVSSNNNGHLESNSAQQEMYALDPL
TFTGPVAFTDSVRMWLESTSGLRWNALSGLRDGGLSKLVGEVLVLPITGFSPGRGQYGNM
GSKSVTDPSARLVHHAQGSWRKTSLLVEYGKFCRTVFGRCRDWSKVPHNFIT

Enzyme Prediction     

No EC number prediction in P175DRAFT_087860-t39_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.20e-14	94	295	79	263	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.73e-10	114	198	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW36299.1|GT32	3.82e-181	1	408	1	412
QMW48355.1|GT32	3.82e-181	1	408	1	412
UDD65561.1|GT32	1.09e-180	1	408	1	412
QRD92708.1|GT32	9.55e-180	1	408	1	414
BCR93027.1|GT32	2.37e-179	3	407	2	408

PDB Hits     

P175DRAFT_087860-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.46e-22	85	381	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.29e-19	86	381	81	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	9.45e-15	97	382	96	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	7.32e-11	94	351	127	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UT67|IMT2_SCHPO	3.28e-06	97	187	82	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000009

TMHMM  Annotations     

Start	End
7	29