CAZyme Information: P175DRAFT_0560664-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0560664-t39_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		61796.72	5.4582

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000010:198155-199893(+)

Full Sequence      

MSVRGLCKALVSGSLVSRAWASASLYEERGAKTYTEPFRPQYHFSPAQNWMNDPNGLVYV
NGTYHLFYQYNPGGIVWGAMSWGHATSDDLTHWEHQPLAFLARGFPDNMTEMFFSGSAVV
DEQNTSGFGNGDAAPLVAMYTSNYLTDQTLPSGKQVRESQQSQSIAYSTDQGKTWTTYDE
ANPVILEPPAPYKDQYQQFRDPNVFWHHETNQWVLLVSLASLHKLLIYTSKDLKSWSLVS
EFGPFNAIGGVWECPSLFPLPLDNDESKVKWVALVGLNPGGPPGTVGSGNQYFIGDFNGT
TFTPDSASVYPGNEEANWLDHGPDFYAAIGYNGLPEYERTLIAWMNNWQYGQKIPTSPWR
SAMSIPRQLSLKTINGKAMVVQNPKEDWDSIMAKSGSGSHGSSYRSVAQGVQKLGSLGKA
FAVELTFSDRDVNPSSTGTSEFGIALRATKNFTEQTRIGYDFAEKRVFVDRAKSGDVSFD
ETFASSYSAPLAPAADGTVSLRIFVDWSSVEVFGGQGETTITAQIFPSEDATYAQLFSEG
GSAKNVRLRTRKIHSTWRK

Enzyme Prediction     

EC	3.2.1.80:10	3.2.1.65:10	3.2.1.26:7	3.2.1.153:5	3.2.1.64:3	2.4.1.99:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	43	383	5.3e-97	0.9931740614334471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350134	GH32_Inu-like	3.53e-153	48	371	1	289	glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
214757	Glyco_32	4.43e-149	43	517	1	437	Glycosyl hydrolases family 32.
224536	SacC	4.29e-128	32	544	22	476	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
395193	Glyco_hydro_32N	5.86e-117	43	384	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
350093	GH_J	5.52e-86	52	369	1	291	Glycosyl hydrolase families 32 and 68, which form the clan GH-J. This glycosyl hydrolase family clan J (according to carbohydrate-active enzymes database (CAZY)) includes family 32 (GH32) and 68 (GH68). GH32 enzymes include invertase (EC 3.2.1.26) and other other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). The GH68 family consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10, also known as beta-D-fructofuranosyl transferase), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9). GH32 and GH68 family enzymes are retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) and catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22581.1|GH32	1.87e-284	12	557	3	544
QKX59933.1|GH32	2.43e-276	8	557	4	556
BAC16218.1|CBM38|GH32|3.2.1.80	8.38e-255	2	557	3	701
EAA61090.1|GH32	1.27e-251	30	557	681	1202
ADM21204.1|GH32	2.68e-249	31	557	19	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Y4W_A	7.21e-248	34	557	3	517	Crystal structure of exo-inulinase from Aspergillus awamori in spacegroup P21 [Aspergillus awamori],1Y9G_A Crystal structure of exo-inulinase from Aspergillus awamori complexed with fructose [Aspergillus awamori],1Y9M_A Crystal structure of exo-inulinase from Aspergillus awamori in spacegroup P212121 [Aspergillus awamori]
3RWK_X	6.89e-90	31	543	21	503	First crystal structure of an endo-inulinase, from Aspergillus ficuum: structural analysis and comparison with other GH32 enzymes. [Aspergillus ficuum],3SC7_X First crystal structure of an endo-inulinase, from Aspergillus ficuum: structural analysis and comparison with other GH32 enzymes. [Aspergillus ficuum]
3KF3_A	2.35e-84	39	529	10	479	Chain A, Invertase [Schwanniomyces occidentalis],3KF3_B Chain B, Invertase [Schwanniomyces occidentalis]
3KF5_A	2.54e-84	39	529	13	482	Chain A, Invertase [Schwanniomyces occidentalis],3KF5_B Chain B, Invertase [Schwanniomyces occidentalis]
3U75_A	3.54e-83	39	529	36	505	Chain A, Fructofuranosidase [Schwanniomyces occidentalis],3U75_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],3U75_C Chain C, Fructofuranosidase [Schwanniomyces occidentalis],3U75_D Chain D, Fructofuranosidase [Schwanniomyces occidentalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q76HP6|INUE_ASPNG	4.76e-250	31	557	19	536	Extracellular exo-inulinase inuE OS=Aspergillus niger OX=5061 GN=inuE PE=1 SV=1
sp|E1ABX2|INUE_ASPFI	4.76e-250	31	557	19	536	Extracellular exo-inulinase inuE OS=Aspergillus ficuum OX=5058 GN=exoI PE=1 SV=1
sp|A2R0E0|INUE_ASPNC	2.23e-248	31	557	19	536	Extracellular exo-inulinase inuE OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=inuE PE=2 SV=1
sp|Q96TU3|INUE_ASPAW	5.20e-247	31	557	19	536	Extracellular exo-inulinase inuE OS=Aspergillus awamori OX=105351 GN=inuE PE=1 SV=1
sp|K0E4E1|ECDE_ASPRU	7.33e-229	32	557	26	702	Putative glycosyl hydrolase ecdE OS=Aspergillus rugulosus OX=41736 GN=ecdE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.818212	0.181806

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0560664-t39_1-p1.