CAZyme Information: P175DRAFT_0559887-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0559887-t39_1-p1
• CAZy Family: GT62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	MSFN02000008|CGC3	49596.50	4.2985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000008:126239-127826(-)

Full Sequence      

MLHPLNLRGALALLALIKTVGAIDININDTESIKQAASLSAYGSMTWYTGNDTGGIPGAF
PDKWWEGAALFTSLLLYWHYTGDDTYNPQVKQGMQWQAGDGDYMPSNYSSWIGNDDQVFW
GLAAMTAAEIKLPDVSDGYSWLSLAQGVFNTQAARWDTSTCGGGLRWQIYNYEAGYTMKN
SISNAGLFQLSARLARYTNNATYAKWAEKVWDWCVSSPLVNNETWNVADSTNIENDCTTK
GNTQWTYNYGAFIMGAAYMYNYTEKARWKTAVDGLLNALFDGFFPEKYGGNIIRELCEPD
ESCNDNEILFRGLTTGWLGFTALLVPSTYDSILPKLKASAEAAAKSCSGMSNNTCGVRWY
QSKWDGEVGMEEQIIATDVLSSVLIMEDGAEAPVTATTGGNSTSDPSSGTKDKSETKTTL
RTITTGDKAGAAILTIVFAFSWAGMIAWLIMGE

Enzyme Prediction     

No EC number prediction in P175DRAFT_0559887-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	395	2e-102	0.9608938547486033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.27e-161	32	376	1	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	0.004	162	326	133	282	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65580.1|GH76	6.39e-236	6	453	7	456
UDD65266.1|GH76	5.23e-235	6	453	7	456
QRD92992.1|GH76	3.21e-234	6	453	57	506
UDD65265.1|GH76	3.21e-234	6	453	57	506
CAK46589.1|GH76	2.67e-228	22	452	25	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	4.37e-94	27	428	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.31e-114	9	450	8	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	9.87e-108	13	450	10	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	3.66e-106	10	450	8	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	7.53e-106	22	451	18	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	1.77e-101	22	409	19	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000270	0.999690	CS pos: 22-23. Pr: 0.9722

TMHMM  Annotations     

Start	End
429	451