CAZyme Information: P175DRAFT_0558567-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0558567-t39_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653		74154.70	5.8231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000005:2189966-2192026(-)

Full Sequence      

MAKYEPYPRPDFERKCNWSSLNGLWDFIFDDASCGLLEKWHEAGLPMQAGNHSKREIKVP
YAFQTPASGINLQEAHEVIWYERVIDDIRSDEERAKGYNLLLRFGAVDFESTIWLDGRLV
ETHVGGQVGFDVDVSSAFNELGKKSARLTLRVRDSPTDLTQPRGKQYWGPIPESIFYTPT
SGIWQSVWLESVPMMRVGYSDHGTVVRAVDDVKGKAQVQVVVVGRPTQAKCHVEVQTKLG
RHFLQPVSGDILPGKDMIEFELDMRLGKADMEDGDRPFADVEGAWNNSIGLWAPEHPILY
DLIIRVFDYQQDVVDEVHTTTGVRSLSWETGDGTFRINSKPYFQALVLDQGYWPDTGMTP
PSQEALRADIEMSKRMGFNGCRKHQKVEDPVFLYWANRLGYLVWGEIGNAYEFKDEYINR
FESDWVQVVKRDINHPSLITWTPVNESWGYNSLKDNIDQRNHIRRIYLVTKAMDYTRPIN
DNCGWEHVKTDLTTYHDYSDSAQLAEACSRMQGGILARKSHGDMFVKPLYSGSTVLDPGA
AHKSGAPVICSEFGGVNIAPAKDSQASSRDWGYTTAADPKDLLARLEKLIMAVVKGGHSC
GFVYTQLTDIEQEVNGLYSYDRREKVPAEKVKAIMDAAKDYYYKMVLPFHVKH

Enzyme Prediction     

No EC number prediction in P175DRAFT_0558567-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	15	505	5.2e-88	0.5132978723404256

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.17e-27	4	480	2	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	7.02e-26	20	479	14	445	beta-D-glucuronidase; Provisional
236673	ebgA	1.78e-12	287	477	281	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	6.74e-11	20	193	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
236548	lacZ	2.13e-10	181	479	207	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44902.1|GH2	8.82e-318	7	648	4	647
QRD91609.1|GH2	4.40e-317	7	648	4	648
QMW47280.1|GH2	4.40e-317	7	648	4	648
QMW35218.1|GH2	4.40e-317	7	648	4	648
BCS17126.1|GH2	1.64e-309	7	648	4	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.38e-54	7	634	29	578	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	2.74e-16	76	487	83	453	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6ED1_A	1.14e-15	78	554	78	514	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
4JKM_A	1.24e-13	21	479	18	444	Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
1BHG_A	1.67e-13	7	479	9	459	Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],1BHG_B Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],3HN3_A Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_B Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_D Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_E Human beta-glucuronidase at 1.7 A resolution [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P12265|BGLR_MOUSE	2.45e-14	20	498	40	507	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2
sp|O77695|BGLR_CHLAE	9.82e-14	7	479	26	476	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
sp|P08236|BGLR_HUMAN	9.09e-13	7	479	29	479	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2
sp|A4W7D2|BGAL_ENT38	1.57e-12	91	492	132	500	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1
sp|Q5R5N6|BGLR_PONAB	1.58e-12	10	479	30	479	Beta-glucuronidase OS=Pongo abelii OX=9601 GN=GUSB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0558567-t39_1-p1.