CAZyme Information: P175DRAFT_0554501-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0554501-t39_1-p1
• CAZy Family: GT45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	MSFN02000001|CGC3	58937.21	6.1572

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:4733837-4735558(-)

Full Sequence      

MMRTSFAHGLLASSWASIALAHGAHTTQDHGKEYDYIVVGGGPSGIITAERLAEAKKSVL
LLERGTGPTVATGSNDTLSWNNTLTEIDLPGLSFDIGNLDVWNDYMCTDTGGTAACVLGG
GVTVNYMVFVHPPAHDFDDRWPKGWKWRDVESAADRLYSRNPGSLLPSADGKRYDQGVYT
LLSGFFSKLGWSSVDMSAQPNEKHQVYSHPAWNIKDQKRAGPIRTYLPLAEAHDNFSIRL
GTKVTRLVRDGRRVVGVEAQTGGGQTERIRLAPKGRVILAAGALSTPRILFNSGIGPASQ
IETANKSGIAVPPRHEWINLPVGVGVKDHPIFSIIVKTNGTFAPLDGPAILNGSAGDEIQ
AYEDESSGVLTQGKHRMIFFTSNVASDNQTRYYQGSCAPTADGVVTITSYMTHGLTSSGV
LGLDANQNTVMEQSPYLQTAGDQEAAEMFINQMISDITAPGTGLELHTYTNTSAIIGSLT
GGVHYTSTTKMGLDDGRFNGTAVVDTDAKVYGMDNLFIVDGGIHPDLPTGNIQATVMVVA
EAAVHRILATK

Enzyme Prediction     

No EC number prediction in P175DRAFT_0554501-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	550	2.3e-190	0.9835766423357665

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.50e-54	29	551	3	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.88e-34	35	543	2	482	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	7.39e-26	32	548	4	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	6.96e-25	111	331	8	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	4.47e-15	399	543	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44335.1|AA3_1	8.76e-273	2	549	1	548
GAA84602.1|AA3_1	1.44e-271	2	549	1	548
BCR93747.1|AA3_1	1.44e-271	2	549	1	548
BCS06374.1|AA3_1	1.44e-271	2	549	1	548
CAP85828.1|AA3_1	8.49e-267	6	548	4	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI4_A	2.70e-92	31	549	5	544	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	1.29e-91	34	549	3	536	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	1.48e-91	34	549	8	541	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI6_A	4.11e-90	31	549	227	766	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	1.59e-88	24	549	220	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.56e-88	34	549	235	768	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q988C9|4PADH_RHILO	9.28e-22	30	551	3	537	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A0A248QE08|FAP_CHLVA	2.32e-21	31	543	81	632	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	1.32e-20	32	548	3	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	3.12e-20	32	548	3	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.038938	0.961039	CS pos: 21-22. Pr: 0.9270

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0554501-t39_1-p1.