CAZyme Information: P175DRAFT_0553896-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0553896-t39_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	MSFN02000001|CGC9	69051.59	4.8766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:2894358-2896535(-)

Full Sequence      

MLRIFFFPLLAIAGLGSAITPYVPQTPPLTTPWTDNVGTSPWPEYPRPQLERAQWQNLNG
IWQYRNASGASAIENPPFGETLDNEVLVPSCLESGLSGLQGRYALYSWLSTNFTVPPRWQ
RQNILVNFGAVDYEATVFINRQKVAFHRGGYFEFTVDATEYITFNGTNELLVFVHDPTEG
EGAVIPIGKQRLSPSHIFYTPCSGIWQTVWIEAAPADYITRLDLTADMQGVVTVTVYSAS
GNNTPVVVSVQDGDHTIASQNGTANQQFKFTADGVRLWSPDTPDLYNISVTMGRDQVGSY
TGFRTISKGTVNGVVRPLVNGEFMFLFGTLDQGYWPDGIYTPPNRDAMIYDLKVLKDLGF
NMLRKHIKVEPALFYRACDELGLLVIQDMPALFLAQPNANQQQEFTRQLGLMVNQLKNYP
CIFTWVIYNEGWGQPSTWHPEFGLTDMVKKLDSTRLVDAASGWFDHGAGDFSDNHHYANP
QCGSPFYSRSSRPYDPNRIGIQGEFGGIGNNVTIENLWNVQAAINTIDQTYELDATIDVW
NYRSHTLLSELRDQIQRFSCSVAVWTQTTDVEGELNGLMTYDRRLKRVNEAQWKADINNL
YTAAKQRATVHSEL

Enzyme Prediction     

EC	3.2.1.146:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	50	481	1.9e-98	0.5093085106382979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.42e-34	56	457	13	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	9.08e-30	57	457	14	445	beta-D-glucuronidase; Provisional
236673	ebgA	2.54e-15	113	471	117	478	cryptic beta-D-galactosidase subunit alpha; Reviewed
395572	Glyco_hydro_2	2.57e-08	216	304	4	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
397119	Glyco_hydro_2_C	1.79e-04	346	586	36	287	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64506.1|GH2	0.0	13	608	19	613
BCS20338.1|GH2	0.0	7	607	12	613
BCR96616.1|GH2	0.0	20	612	32	637
BCS09120.1|GH2	0.0	20	612	32	637
QMW41001.1|GH2	0.0	20	607	33	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.40e-110	29	594	12	576	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED2_A	1.17e-24	45	430	30	441	Chain A, Glycosyl hydrolase family 2, TIM barrel domain protein [Faecalibacterium duncaniae]
6D50_A	3.25e-24	48	430	28	426	Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
5UJ6_A	4.27e-24	54	430	26	418	Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D8G_A	1.33e-23	48	430	28	426	D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KPJ7|PLH8_FORAG	4.10e-26	42	460	40	457	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|P77989|BGAL_THEP3	1.20e-20	103	455	54	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|T2KM09|PLH16_FORAG	1.66e-17	108	462	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|A1SWB8|BGAL_PSYIN	1.84e-12	112	470	125	496	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
sp|Q56307|BGAL_THEMA	1.87e-12	8	457	8	464	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000511	0.999477	CS pos: 18-19. Pr: 0.9727

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0553896-t39_1-p1.