CAZyme Information: P175DRAFT_0533502-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0533502-t39_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		24209.14	3.6521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000006:137389-138198(-)

Full Sequence      

MHLISFLLSVGLVSGYNIPDNLQEIYNQHKTEECSHVLADGFSPGGGAGGNEQYCGDIGG
AIFLHSTSGGFADMDIDCDGTDDSGGDCGNDPSGQGQTSFQSQLGDYGISDLNAKVHPYV
VFGNTNFDPQEYGMEPLSVMAVVCGGQLHYGIWGDTNGGDLTGEASISLAKLCFPDEGIS
GDNGHTDDDVLYLGFTGSNAVPGNNADWAAENAQAFEESIKGLGDELVSSLSS

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	9	229	4.8e-79	0.9590909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	3.61e-90	74	230	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJG44374.1|GH75	2.18e-102	7	232	10	241
QRD91118.1|GH75	1.59e-92	4	231	3	239
QMW46870.1|GH75	1.59e-92	4	231	3	239
QMW34800.1|GH75	1.59e-92	4	231	3	239
BAE64590.1|GH75	1.59e-92	4	231	3	239

PDB Hits     

P175DRAFT_0533502-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	4.48e-102	7	232	10	241	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	2.83e-93	4	231	3	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	7.31e-93	4	231	3	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U3M5|CSN_ASPOR	3.12e-86	7	231	6	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	3.12e-86	7	231	6	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999690	CS pos: 15-16. Pr: 0.9815

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0533502-t39_1-p1.