CAZyme Information: P175DRAFT_0531848-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0531848-t39_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		68759.24	6.2383

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000004:189373-191231(+)

Full Sequence      

MRSPRLLGLLVTGVLVCLSLVFLRHSRPSHGSPRVASLVSPPPPPLQQPMAPAPAHADLY
PKDVHPIAALIQDAEEEFNELLSRQSKNLADAVKEYRRRYGLHPPPHFDKWFIFAQSRGV
QLIDEYDTIYETLLPFWALAPETIRARAREALGYDNSLLGILIRDGKVSLAEGGLTEEQT
WQRVATLGMMKEFVQYLPDLDLVFNAHDEPRVILPSEDLQRLVAYAKDHAIPTAFQTTSI
VNEWSDRPSDLNRGDRIDEVRTTRFNRFSHQPAWTSSRMSCPVESPVRSLDENAPDNTDR
YAHGDLGFIYNTSAFSDICNAPSLRYTYGFFDRPNVFAVVHDLFPVFSQSKISSFQDILY
PSPWYWAKKVPYVGEKDVSWEDKTDKLYWRGSTTGGYSRGGGWRRQHRQLMVGNINALNT
AEILSRGENGHWGRKQVSRQEYHALFDVQFTSIGQCDAHDCAAQREFFNVSEPAGQQEAW
GYKYLIDIDGNAFSGRYHAFLESNSLVCKVALFREWHDERIKPWVHYVPLSFRGDEFVET
MRYFVSEDAGRTAGPRLAQNGQEWAQRSLRNEDMEVWFFRVLLEYGRLVDDNRDNLGFY

Enzyme Prediction     

No EC number prediction in P175DRAFT_0531848-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	321	589	2.7e-81	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	6.80e-20	305	588	4	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	8.81e-11	345	588	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58972.1|GT90	0.0	2	584	4	585
UCK57446.1|GT90	3.54e-311	1	598	11	617
BAE54850.1|GT90	1.41e-310	1	598	1	607
BCR83603.1|GT90	4.77e-309	1	598	1	598
BCS23821.1|GT90	2.14e-301	2	598	4	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	9.62e-09	322	592	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.66e-08	345	589	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.15e-63	65	595	152	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	2.60e-09	345	589	163	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	2.52e-08	345	589	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	4.45e-08	345	589	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	5.69e-08	322	592	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000027

TMHMM  Annotations     

Start	End
7	24