CAZyme Information: P175DRAFT_0529699-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0529699-t39_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		32759.67	4.6950

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:1531387-1532507(-)

Full Sequence      

MRVAALLPFLTAAMPAAAAAARGTFGLALGNQNTDKSCKSSSDYEADFDAIKGLTTLVRT
YSASNCDTAKNIIPAAKAKGFKVVLGVWPDYDQSFNEDFAALKASVPGNEDVIHAITVGS
ECLYRGDITVDKLLSRINQVKKQFPTVTVGTVDSWNKFADGTADPIIQGGVTYILANGFA
YWQGQQIDNATKTYFDDMAQAKARIEQIAGDNAKNIQFGTGETGWPTDGGSDYGAAKAST
TIAAEYYKRAVCGMLAWGVDVFYFEAFDESWKPDSVGDNGKAMDEKHWGLFTADRKAKFD
TACE

Enzyme Prediction     

No EC number prediction in P175DRAFT_0529699-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	26	303	7.6e-41	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.45e-70	23	295	44	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.71e-43	33	303	10	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66273.1|GH17	6.11e-173	1	303	182	483
BCS25884.1|GH17	2.45e-169	1	303	1	301
BCR86239.1|GH17	2.29e-166	1	303	1	305
CAK45395.1|GH17	1.54e-160	1	303	1	301
BCS09817.1|GH17	1.07e-158	1	303	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	5.29e-33	35	298	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.81e-32	35	298	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.27e-123	1	304	1	302	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	1.86e-73	23	304	25	311	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	7.24e-72	20	304	17	306	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	8.19e-71	20	304	17	306	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	7.71e-66	19	303	36	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000325	0.999648	CS pos: 19-20. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0529699-t39_1-p1.