CAZyme Information: P175DRAFT_0527131-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0527131-t39_1-p1
• CAZy Family: GT24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MSFN02000001|CGC10	31137.70	6.6148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:226939-227966(-)

Full Sequence      

MVTLSSLVFGLSAAAGVFALPSDLSGELSKRQTITTSQTGTNNGFYYSFWTNGDGAVSYT
NGNAGEYSVTWANQNGGDFTCGKGWNPGSAHDITFSGTFSPSGNAYLSVYGWTTSPLVEY
YILESYGDYNPGSSMTHKGTVTSDGATYDIYEHQQVNQPSISGTATFNQYWSIRRSKRSS
GIVTTANHFNAWASLGMKLGAFNYQIVSTEGYESSGKSTITVSSGGSSSSGTSKSSTTTT
TKTTTHTTASDRTSSGGSESCASIYAQCGGLGWKGATCCASGSTCTYSNAYYSQCLA

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	43	221	1.1e-72	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	4.01e-102	43	219	1	175	Glycosyl hydrolases family 11.
197593	fCBD	3.76e-11	265	296	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	4.77e-11	265	292	2	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV23009.1|GH11|3.2.1.8	8.20e-131	1	225	1	225
ACP27609.1|GH11	5.19e-127	1	225	1	225
AQY10337.1|GH11	1.38e-118	1	223	1	217
AGW24301.1|CBM1|GH11	4.25e-118	1	296	1	310
ADX86897.1|CBM1|GH11	4.25e-118	1	296	1	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WP3_A	5.49e-100	26	223	12	207	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
1TE1_B	8.24e-98	32	223	1	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
5HXV_A	1.38e-91	34	223	3	190	Chain A, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_B Chain B, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_C Chain C, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_D Chain D, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_E Chain E, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_F Chain F, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_G Chain G, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_H Chain H, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_I Chain I, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_J Chain J, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_K Chain K, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612],5HXV_L Chain L, Endo-1,4-beta-xylanase [Talaromyces cellulolyticus CF-2612]
7DFM_A	2.49e-78	34	223	5	191	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
4XPV_A	1.68e-77	39	223	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQ4_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQ4_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],6JXL_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],6K9O_A Crystal Structure Analysis of Protein [Trichoderma reesei RUT C-30],6KWD_A Crystal Structure Analysis of Endo-beta-1,4-Xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E7EF85|XYNB_PENOX	7.54e-119	1	296	1	310	Endo-1,4-beta-xylanase B OS=Penicillium oxalicum OX=69781 GN=xynB PE=1 SV=1
sp|B7SIW1|XYNB_PHACH	7.51e-107	1	296	1	290	Endo-1,4-beta-xylanase B OS=Phanerodontia chrysosporium OX=2822231 GN=xynB PE=1 SV=1
sp|W0HJ53|XYN2_RHIOR	7.99e-106	1	223	1	216	Endo-1,4-beta-xylanase 2 OS=Rhizopus oryzae OX=64495 GN=xyn2 PE=1 SV=1
sp|Q9HFH0|XYNC_TALFU	9.04e-102	4	223	5	223	Endo-1,4-beta-xylanase C OS=Talaromyces funiculosus OX=28572 GN=xynC PE=1 SV=1
sp|P48824|XYNB_ASPKW	8.05e-96	6	222	5	224	Endo-1,4-beta-xylanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=xlnB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000346	0.999626	CS pos: 31-32. Pr: 0.5686

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0527131-t39_1-p1.