CAZyme Information: P175DRAFT_0524772-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0524772-t39_1-p1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929		103434.85	6.6382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000006:385078-387956(-)

Full Sequence      

MTVYIASLFLPHTVRFRAPTSQDRFAESQPEKQLATSAPTKHTPETVATATATATATSLF
ERQNGDPSVGLTPGATTDHERIFSASPKEAAEGTHHHQHLLTESEAHSPAWGARTALNQP
KPQSAFVASPSILRHQDPIAVPEPAPVREAPLVPAKYLKPSYHGTRKGSFCEADWTITTA
EQGNGGLRNAVRSAAETGQLQDKVWVGTLGIPTDALTQYTKAAISEKLEGEYDSLMVDVS
DIDFDGHYTHFCKTILWPVFHYQIPDNPKSKAYEDHSWVYYVKLNQAFADRIARNWKRTD
SIWIQDYHLLLVPAMLRQLLPDAQIGFFLHVAFPSSEVFRCLAPRKELLEGMLGANLVGF
QTEEYCRHFLQTCSRILSVEATNEGLQLEDRVVNVGKFPIGIDPLSWDKRRKAADVEQWI
QTISDRYAGKRLIVSRDKIDQVRGIRQKLLSYELFLNTYPEWREQVVLIQVATSTTEQPE
LEATISDIAMRINSTHSTLAHQPLVFLKQDLAFPQYLALISVADALMITSLREGMNLTSH
EFVYCQDGKYGRQQYGSLILSEFTGSASVFGHHALLVNPWDYRQCAEAIHTALSRGEAER
RAVWQQLHQAVLQNSTSNWVASFSATLRRVWHEQSSREIMAVPRLRLDQLEARYRQSTTR
RLIILDYEGTLASWGSPRSMMIVTTTTTTTPQRAITALAELTDDPKNVVYVMSSRTPEEL
ARLFRLVGGVGLIAENGCFVREPHGGEAWTSTFPESSTRQAWQAAVRQILAYYQQRAEGS
WIEQRHCSLVFHYEAAEDQAAACRLASECADHINDACASQGVVHAVLVEGVLVVEPRDTN
KATAADVVWRAMNSGGGGGGVDFLLAIGGDRDDEPIFRWANKLASSGGVEYVMTVTLGTR
RTEARATMGHGVTGVVGCLERLAQTTMKN

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	178	629	2.1e-158	0.9305263157894736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	176	623	19	458	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	174	629	23	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	9.72e-164	172	635	31	486	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
184712	PRK14501	1.76e-159	185	878	28	688	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	1.43e-127	172	797	29	636	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA58930.1|GT20	0.0	1	914	1	911
QMW41842.1|GT20	0.0	1	928	1	927
QRD86165.1|GT20	0.0	1	928	1	927
BAE60220.1|GT20	0.0	1	928	1	927
QMW29769.1|GT20	0.0	1	928	1	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	6.08e-98	184	630	27	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5DXF_A	8.81e-97	246	623	146	519	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HVM_A	8.43e-90	176	630	24	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	4.20e-89	184	638	31	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	4.20e-89	184	638	31	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	6.75e-194	177	922	202	941	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	5.14e-181	4	906	5	874	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38426|TPS3_YEAST	4.34e-153	170	855	309	958	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	1.16e-147	170	854	341	992	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	9.63e-113	194	797	48	628	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997696	0.002370

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0524772-t39_1-p1.