CAZyme Information: P175DRAFT_0519267-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0519267-t39_1-p1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	MSFN02000011|CGC1	83495.75	4.6639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000011:164852-167770(-)

Full Sequence      

MNLFTRRLAAAVAGSSSPPTLYTDSDTGITFDTWTVAASSSAAGLTFGMALPGDALTTDA
TEFIGYLSCNSANGKGTGWCGLSMGGSMTSKLLLMAYPSGDRVLTSFRFSSGYVMPDLYT
GNATVTQISSSINATGFTLLFRCQNCLAWDQGGTTGSVSTSAGQLVLGWAQAKKSPTNGA
CPGDLSLVQHEAQSIWAAKFDKNAASSSYEAWTKLATTVVTGDCDGSPGGGGNGTEPVGT
PVPDGAVYDYIVVGSGPGGMVMADRLSEAGHKVLLIEKGPPSLGIWGGTMKPAWLEGTEL
TRFDVPGLCNQIWVDSDGIACPDHDQMSGCLLGGGTAINSGLWWSPYSKDFDENFPDGWK
YNDMKKAISKVFSRIPGTIHPSMDGFIYLQEGPSVIMNGLLAAGWKMTSFDDSPEEKYRS
IGYSPYMFSNGQRNGPLATYLVTAHERSNMDMWLNTTVRRVIRDGSRITGVEVEPFLDGG
SQGVVNITASSGRVILSAGAFGSPKILFRSGIGPKDQLTVVKNSALDGDTMINESQWIEL
PVGKNLMDHPNTEVVVQHPDIIPYDFYGAWENPIEGDKERYLTNRTGPLAQAAPNVNPIF
FDQVTGPDGITRQLEWQARVEGSHNIPDGHTITMTQYVGRGQTSRGRMTINAQLNTVVST
LPWLTDQNDVDAAIQGIERLQASLKNVTDLTWAFPTANVSIPDFVNSLPSTGRGSNHWMG
SCKMGPDDGRDGGSAVVDLNLKVYGTDNLFVVDASIFPGMISANPSAYITSVAERAAERI
LGL

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	237	782	1.4e-229	0.9835766423357665
AA8	22	212	8.7e-68	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	1.56e-73	22	208	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	3.88e-60	241	782	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	7.62e-48	22	196	2	164	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
274888	Rv0697	8.65e-42	249	778	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	1.68e-37	248	782	6	533	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19750.1|AA3_1|AA8	0.0	1	783	1	792
EAA61277.1|AA3_1|AA8	0.0	1	783	1	778
QMW43910.1|AA3_1|AA8	0.0	1	783	55	843
UDD60845.1|AA3_1|AA8	0.0	1	783	55	843
QMW31885.1|AA3_1|AA8	0.0	1	783	55	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	0.0	19	781	4	764	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	0.0	19	783	5	767	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI4_A	2.03e-245	241	783	1	545	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	4.18e-125	241	783	1	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	5.04e-125	248	783	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	4.01e-149	22	783	24	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.40e-31	248	782	5	529	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	1.50e-27	248	781	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	4.74e-27	248	781	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	3.69e-25	248	782	5	532	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984547	0.015469

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0519267-t39_1-p1.