CAZyme Information: P175DRAFT_0518235-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0518235-t39_1-p1
• CAZy Family: GT109
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MSFN02000007|CGC1	92267.40	4.6626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000007:1184896-1187747(-)

Full Sequence      

MHLSILPPLLAPLLCAVGVLSQGSTEDVSVLASEAARANNQSLLWGPYKPNLYFGVGPRI
PNSLSAGLMWAKVDNFATAQQNFRHTCEQNDGMAGYGWDEYDIRKGGRETIHDAGNSLDL
TIDFIKVPGGQHGGSWAARVKGVPRDDALPDQPVTIVFYSGLEGLGNLGVTTESEDPRGF
EDDVKLSGYTSDLGDFTIDITTGAKTNAYPQHDHPSYEDKPLDRTFVASLSVQPEHIWQS
KMILFSQMKKAVDECIGKYGAEDPPPPPQVFTINNAPGDGNVQYVQKVFAGAFEFDILFS
SGSAPQPLTSETITREIESTSLSFAERFEKILSPQAPFNSPKYLEFSKSMFSNLVGGIGF
FHGSDLVDRSAASAYDEEDEGFWEEAAEARARAQPVMEGPKDLFTCVPSRPFFPRGFLWD
EGFHLLLVIDWDTDLALEIVKSWFNLMDENGWIAREQILGAEARSKVPAEFTVQYPHYAN
PPTLFLVVEAFVDKLDAQKKNSSIGIFAEDDNTESLRSAFLKHPELGEAYMRSIYPLLKT
HYFWYRSTQTGDITSYDREAFSTKEAYRWRGRTVQHILTSGLDDYPRPQPPHPGELHADL
ISWMGMMTRTLRRIANALGETEDAEMFQNYETAIARNIDDLHWDDGAQTYCDATIDEYEE
SVHVCHKGYVSISPFLTGMVGPDSPRLKAMLDLIEDPEELWSDYGIRSLSKRDELYGTAE
NYWRGPVWMNINYLVLKNLHDTATAPGPQQERARVMYSKLRKNLVENVFREWKKSGFAWE
QYNPETGNGQRIQHFTGWTSLVAKMMSMPDLPASGKKGHDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	595	806	6.5e-34	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	308	808	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.92e-127	43	266	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.66e-06	609	740	428	549	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD57712.1|GH63	0.0	19	822	16	817
BCS17840.1|GH63	0.0	1	822	1	818
QRD84190.1|GH63	0.0	19	822	16	817
QMW44709.1|GH63	0.0	19	822	16	829
QMW32679.1|GH63	0.0	19	822	16	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	8.15e-176	34	806	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.11e-133	43	807	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	3.70e-245	28	807	27	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	1.84e-176	19	806	19	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	7.51e-134	43	807	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	5.80e-129	32	807	83	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
sp|O88941|MOGS_RAT	2.08e-128	45	807	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000288	0.999669	CS pos: 21-22. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0518235-t39_1-p1.