CAZyme Information: P175DRAFT_0515417-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0515417-t39_1-p1
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		37486.20	5.3479

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:4087611-4088631(+)

Full Sequence      

MPLLIPPYPLPMKIFILPSLSLSTVASSFALPLHNPTKDIPILGSDTADFTHYKFWDFRA
MSTVQNTTQIPLEHTPFNTAWEAQSWRREPTGDSSWPMVNSKANVFLTQHPDQPSSSILV
LRTTRFSNYFSTAEIESRLGNYQHCSWRVRMRLMSQSTISENDSPSQDPGRAAERVPPGA
CAGMFIYRSATCESDLEILTSDSQRTIHYANQPDYDPVSDRMTPGFSRTVTDLPAPWTTW
VTHRMDWAPGATRWYADDQLQTVIELGVPDRPSLVALNLWSDGGVWTGDMAVGQSVYLGI
EWIELAYNLSTPGLDVPFRFRRKTSGKDGGFLE

Enzyme Prediction     

No EC number prediction in P175DRAFT_0515417-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	79	305	3.4e-78	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	4.76e-44	81	304	13	208	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	0.001	242	303	142	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29547.1|GH16_22	3.17e-110	17	314	23	337
EAA63092.1|GH16_22	1.77e-109	31	330	45	373
CAK42110.1|GH16_22	9.74e-96	16	319	9	353
BCR99502.1|GH16_22	1.53e-95	50	319	59	351
BCS11802.1|GH16_22	1.53e-95	50	319	59	351

PDB Hits     

P175DRAFT_0515417-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

P175DRAFT_0515417-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.476264	0.523726	CS pos: 30-31. Pr: 0.4173

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0515417-t39_1-p1.