CAZyme Information: P175DRAFT_0512861-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0512861-t39_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MSFN02000001|CGC13	45055.97	7.1577

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:236718-238433(+)

Full Sequence      

MAEFVGSRTKLAGYCTTYVRVLLYHRWLPDYDVGEIPRFLHRSPYRESPDREYESSVSEA
LRRIEQRALAQNGRDLVAEERIWQIRIGKQFTKEQRGSDSHAFEEKNHEWKYTLVTDDEA
HGYISSLFSTVPDLENLYNSYPYDVLRSDLLRYLILWYFGGYYADMDVFPAQSIKQCRTL
RPILSDLRAGSANISLLVGVEIDEPYASTRLMHDWRWIRRYGLIQYTMYAPQRFSPFLRE
AVVRVLAHTRQHHRSSIPILGPTYSQETILEVTGPGVFTDAVLDVLSNTLPPAHPLVASS
VESDLGIGDLIAPASGQVARRVTWAPFHKIREPVCVDAQDAAVGSAMGGLCVLPVSVWGN
GQRHSGAENFQGAHACVNHRFGGSWKKEWWRPYFG

Enzyme Prediction     

No EC number prediction in P175DRAFT_0512861-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	105	177	5.2e-18	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	2.48e-14	105	174	13	83	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	5.04e-09	106	174	109	174	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21634.1|GT32	1.17e-182	26	395	46	414
EAA64318.1|GT32	4.08e-179	26	395	50	417
QMW25899.1|GT32	4.73e-165	25	395	47	413
QRD88070.1|GT32	4.73e-165	25	395	47	413
QMW37982.1|GT32	1.10e-163	25	395	47	413

PDB Hits     

P175DRAFT_0512861-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	5.96e-22	83	388	107	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.79e-15	110	388	172	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	8.33e-14	80	388	98	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	2.66e-13	103	333	154	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	5.57e-06	109	184	87	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0512861-t39_1-p1.