CAZyme Information: P175DRAFT_0512839-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0512839-t39_1-p1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723		80088.54	6.3286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:164239-166574(-)

Full Sequence      

MADAIANDDNGTSFALNGKNVSYRFHVDESNGDLRTDHFGGSITGPIPADPAPVVDGWTG
MPDRVRREFPDQGRGDFRVPAIRIRQSEGHTVSALQYQSYEIVKGKPELPGLPATFGNHG
DVTTLVVHLYDKYSQIAVDLVYSVFPLYDAIVRSVRVTNKGNQEISIEALASFSVDFPYE
KFDMIGLRGDWAREAHRQRRKVEYGLQGFGSTTGFSSHLHNPFVALVHASTTESQGEAWG
FSLVYTGSFSASVEKGSQGLTRVQLGFHPNQLSWSLCPNETLTSPECVAVYSKDGIGGMS
RSFHRLYRNHLMKSKFATDNRPVLLNSWEGLYFDIDKRSMYHLAEESAALGVKLLVMDDG
WFGDKYPRISDTAGLGDWVPNPARFPEGLAPLVNKITSLKVTGSSTNLRFGIWVEPEMVN
RNSTLYQEHPDWVLHAGQYPRTEQRNQLVLNLALPEVQNFIIDSISDILKCADITYVKWD
HNRGIGEMPSPSTNHAYMLGMYHVLHALTSRFPDILWEGCASGGGRFDPGILQFFPQVWT
SDNSDAVERVFIQFGTSLAYPASAMGAHISGVPNHQTGRTIPLVFRAHVAMMGGSFGLEL
VPADMQPAEKAAIPGLIALAEKVNPIILTGDMWRLSLPEDSNWPAALFISADGSRAVLFF
FQLSPYVNHTMPRVRLQGLDPLSTYRVDGEGPYTGAMLMNLGLQYSFQTDYASKVAFLEK
AKQ

Enzyme Prediction     

EC	3.2.1.22:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	14	704	2e-239	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
307952	Melibiase	0.0	281	630	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	3.16e-159	14	704	4	666	Alpha-galactosidase [Carbohydrate transport and metabolism].
269892	GH36	2.79e-125	321	622	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	1.49e-103	32	276	1	255	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
407115	Glyco_hydro_36C	3.73e-24	643	718	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21684.1|GH36	0.0	10	719	14	721
EAA64367.1|GH36	0.0	11	720	17	725
ABF50896.1|GH36	0.0	11	720	17	725
QNV47917.1|GH36	0.0	11	720	15	725
QMW36232.1|GH36	0.0	11	720	40	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JHP_A	0.0	11	720	49	757	Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']
4FNR_A	8.49e-192	63	723	70	729	Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNQ_A	6.78e-191	63	723	70	729	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	1.92e-190	63	723	70	729	Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	2.71e-190	63	723	70	729	Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AU92|AGALC_EMENI	0.0	11	720	41	749	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1
sp|Q0CVH2|AGALC_ASPTN	0.0	10	720	36	746	Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglC PE=3 SV=1
sp|Q2TW69|AGALC_ASPOR	0.0	11	720	40	750	Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglC PE=3 SV=1
sp|Q5ARP5|AGALG_EMENI	0.0	11	720	17	725	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
sp|Q0CEF5|AGALG_ASPTN	0.0	11	720	15	724	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000019

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0512839-t39_1-p1.