CAZyme Information: P175DRAFT_0510240-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0510240-t39_1-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MSFN02000005|CGC3	44778.98	5.0268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000005:2027699-2029465(-)

Full Sequence      

MLALLLLAFISWSQWVSATILQNGQVRENPYPGQAVTIELDGNWRNYTRDAPEISYKGRW
DSYYTSWWSVPGIKFAFTGEKLAIGFGQNTSDGVLVAYRLGGMNWQFSNVTADSTCQFIG
PWTPGLNETDQAQNKTFELRVQITGISVTEGSKLVAVPNLKKSVEIIGDSLASGMHGTYE
GLSGWAFGFAAGLGNVEYSITAYPGICLVDRECYNGSSRGMTYAWYYTSDVGVRAQTAYG
DNPEPWNFTSQQSADLAVIDLGTNDARYPNEIPGDHFVSSYVELINTVHKVWPEAQVVLM
SLWGNFERSRDTYIQRPMYQSAVQQVQAHFQKAGFVHYFDTRGILQHNDIAPLNHPTDIG
HIKVASHLMQWVQLKLGWEFGTQGEEIQSGTTYWNNQSSY

Enzyme Prediction     

No EC number prediction in P175DRAFT_0510240-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	166	371	1e-19	0.9760765550239234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	4.41e-44	164	373	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	1.52e-16	164	370	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.40e-15	166	361	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	8.35e-05	161	365	1	185	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.12e-04	164	368	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34907.1|CE0	1.51e-192	10	400	8	398
QMW46983.1|CE0	1.51e-192	10	400	8	398
QRD91240.1|CE0	1.51e-192	10	400	8	398
BCS11519.1|CE0	2.34e-167	53	400	24	368
BCS17295.1|CE0	6.30e-166	6	400	4	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XVH_A	4.29e-08	68	378	17	329	Crystal structure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

P175DRAFT_0510240-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999775	CS pos: 18-19. Pr: 0.9708

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0510240-t39_1-p1.