CAZyme Information: P175DRAFT_0505426-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0505426-t39_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194		21292.22	5.6914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000014:75701-76342(-)

Full Sequence      

MCSLLTLHRASLGTNDAVQKYHVDTAGDRIDALLTELFNQINGTTIILSTLLPNTKQPRI
AEQISRQYRNVAARRRAQGDRVVLAEMSYFIKSDQLADGTHPTDSGYKEMASVWWAAIQE
AEREGMLQAPNNIGEVGVLTQAKEASLDDSITNPNLPDYTAPAQPVVADNARSIRPCRLC
LVAVIPAVMFLLNS

Enzyme Prediction     

No EC number prediction in P175DRAFT_0505426-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	11	118	1.1e-30	0.5721649484536082

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.69e-28	12	118	48	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	1.41e-09	11	117	72	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.03e-06	11	108	68	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238866	sialate_O-acetylesterase_like2	3.55e-05	13	120	57	166	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
239945	SGNH_hydrolase_like_4	5.03e-04	13	118	68	183	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30471.1|CE3	1.41e-53	11	175	139	314
CAP86338.1|CE3	1.05e-51	13	171	136	295
EAA61410.1|CE3	3.32e-49	11	165	254	417
BAE62547.1|CE3	4.78e-39	13	133	139	261
UDD56943.1|CE0	3.61e-38	13	135	139	263

PDB Hits     

P175DRAFT_0505426-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

P175DRAFT_0505426-t39_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000004

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0505426-t39_1-p1.