CAZyme Information: P175DRAFT_0502201-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0502201-t39_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MSFN02000005|CGC9	41268.14	5.9401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000005:1153514-1154653(-)

Full Sequence      

MGTLFMSPSRYVAAIVVFLLIFNMYLFNRVIRLTTQNEEFCDTSLHTSPPTAAVTTSPTT
VDPLPKPVTVTVTNIVTTTTTVTPNDTPANPPVKGHGSSSSSSSSSSSLSVQNPATAAIP
AKIWHKCGHKGVNDDARKLIDQWLEKNPNFRHEVLTDESGDQYVREHYADWPEVVDTFMA
LTVPILKADFLRVLIMYADGGIWSDLDVACEVPVAEWIPKKLANDPLHPINVVVGIEFDG
WQFASWTVMAKPRLAHFERTIRYVLDQIQKLAADNHVSIPAITKPMIPDVVAVTGPQAIT
IALLQSVSAATGQDIQKQAILNLKEPTLIGDILVLPQAAFAALQGGFPKDQGPYLVSHHY
SGSWKNDVGGEEGVKPPSS

Enzyme Prediction     

No EC number prediction in P175DRAFT_0502201-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	136	220	1.4e-20	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.81e-19	117	252	80	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.13e-14	134	219	2	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA62114.1|GT32	1.44e-156	1	378	1	371
BCS30122.1|GT32	3.30e-151	1	379	1	373
QQK40626.1|GT32	8.78e-102	115	371	89	341
CAP80736.1|GT32	4.58e-99	115	371	89	341
CAK40793.1|GT32	5.80e-97	114	375	98	354

PDB Hits     

P175DRAFT_0502201-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.54e-27	114	367	137	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	2.13e-22	120	366	131	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	6.58e-22	109	367	87	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.29e-13	117	252	94	270	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	5.55e-07	139	249	75	208	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

Start	End
10	27