CAZyme Information: P175DRAFT_0500103-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0500103-t39_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MSFN02000002|CGC9	45910.17	5.0013

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000002:3996528-3997828(+)

Full Sequence      

MMSYYHGNESGQIPGKLPGTWWEGGAMFMTLIQYWYWTGDTSYNDVTAQGMLWQKGHDDY
FPSNDSNYLGNDDQVFWGLAAMTAAELKFPEQDDQPSWLSLAQGVFNTQVPRWDTTTCKG
GLRWQIWPYLAGYTTKNAISNGGLFQLAARLGRYTQNETYIQWAEKIWDWSATTPLLKLT
EWTIADTTSIEAQCQDHGDIQWTYNYGTYLSGAAYMYNLTNGHEKWKSAIDGYLRTTFSK
FFPAEYGGQVMSEISCEPTMNCDRNQDCFKGFLSSWLTFIATIVPYTSSEIMPKIQQSAL
AAARQCVGGDSGSQCGRRWHQNTWDGSTSLESDMSALSVISSTMIAFHQGAEPLTSHSGG
TSKSNPTAGTGTHKGTPNQPKPITTGDRAGASILTILFLGTWISGVAWMIYGG

Enzyme Prediction     

No EC number prediction in P175DRAFT_0500103-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	1	354	5.8e-99	0.9189944134078212

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.47e-174	1	337	13	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43770.1|GH76	2.41e-253	1	413	40	456
BCR95806.1|GH76	1.00e-251	1	413	46	462
BCS08339.1|GH76	1.00e-251	1	413	46	462
QMW25974.1|GH76	2.52e-246	1	413	43	457
QRD87981.1|GH76	2.52e-246	1	413	43	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	8.58e-95	1	388	47	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	3.97e-97	1	410	43	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	1.36e-96	1	411	40	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	4.70e-95	1	411	43	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q9P6I3|YHG7_SCHPO	3.04e-94	1	411	41	442	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|O74556|YCZ2_SCHPO	8.55e-94	1	369	41	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.987755	0.012266

TMHMM  Annotations     

Start	End
389	411