CAZyme Information: P175DRAFT_0496921-t39_1-p1

Basic Information

• Species: Aspergillus ochraceoroseus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus ochraceoroseus
• CAZyme ID: P175DRAFT_0496921-t39_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	MSFN02000001|CGC20	60383.72	6.2935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AochraceoroseusIBT24754	9070	1392256	153	8917

• Gene Location: location=MSFN02000001:553486-555233(+)

Full Sequence      

MAPVTTNDFPASDVNSYDYVIVGGGTAGCVIASRLAEYLPNKRILVVEGGPSDYMNDRVL
NLREWLNLLGGELDYDYPTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKRWE
QQGCKGWSFETFTRVLDGLRNTVQPVHERHRNQLCKDWVQSCSTAMNIPIIPDFNQEIRS
QGELTEGVGFFSVAYNPDDCRRSSASVAYIHPIIRGDEKRPNLTILTNAWVSRVNVEGET
VTGVDITLQSGVQHTLRAKKETILCAGAIDTPRLMLLSGLGPQKQLASLGIPVVKDIPGM
GENLLDHPESIIIWELNQPVPPNQTTMDSDAGIFLRREIPNAAGTDGRAADIMMHCYQIP
FCVNTERLGYDTPVNAFCMTPNIPRPRSRGRVYLTSADPTVKPALDFRYFTDPEGYDAAT
IVAGFKAAREIAKQSPFKEWIKREVAPGPKVQTDEELSEYGRRVAHTVYHPAGTTKMGDV
TRDPMAVVDPQLKVRGLKNVRIADAGVFPEMTSINPMLTILAIGERAAELIAEEAGWKRE
QPKL

Enzyme Prediction     

No EC number prediction in P175DRAFT_0496921-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	533	8.7e-138	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.03e-121	15	536	6	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.78e-114	15	531	4	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	9.99e-48	386	527	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.13e-30	15	524	54	569	Protein HOTHEAD
366272	GMC_oxred_N	3.46e-24	17	309	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64559.1|AA3_2	0.0	5	544	3	542
QMW36122.1|AA3_2	0.0	5	544	3	542
QRD92907.1|AA3_2	0.0	5	544	3	542
QMW48182.1|AA3_2	0.0	5	544	3	542
BAE65509.1|AA3_2	0.0	5	544	3	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	9.72e-125	17	531	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.37e-124	17	531	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.87e-124	17	531	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	2.11e-55	17	535	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
7AV4_AAA	5.21e-55	17	535	84	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	5.00e-124	17	531	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	4.06e-77	16	532	6	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.52e-71	17	534	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	2.70e-70	12	531	2	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1
sp|Q6G664|BETA_STAAS	3.86e-70	16	531	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000019

TMHMM  Annotations     

There is no transmembrane helices in P175DRAFT_0496921-t39_1-p1.